BLASTX nr result
ID: Ophiopogon25_contig00022751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022751 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT29598.1| hypothetical protein POPTR_006G039100v3 [Populus ... 53 5e-06 ref|XP_020101911.1| uncharacterized protein LOC109719562 [Ananas... 52 8e-06 ref|XP_009381370.1| PREDICTED: uncharacterized protein LOC103969... 52 8e-06 >gb|PNT29598.1| hypothetical protein POPTR_006G039100v3 [Populus trichocarpa] Length = 71 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 105 EEEICGGDMPHRTRPMTALLAFMGLNLVLVSTISP 1 +E G MPHRTRPMTALL F GLN++LVSTI+P Sbjct: 5 KESCLEGTMPHRTRPMTALLVFTGLNVILVSTITP 39 >ref|XP_020101911.1| uncharacterized protein LOC109719562 [Ananas comosus] Length = 60 Score = 52.0 bits (123), Expect = 8e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 81 MPHRTRPMTALLAFMGLNLVLVSTISP 1 MPHRTRPMT+LL FMGLNLVLV+T+SP Sbjct: 1 MPHRTRPMTSLLLFMGLNLVLVNTVSP 27 >ref|XP_009381370.1| PREDICTED: uncharacterized protein LOC103969536 [Musa acuminata subsp. malaccensis] Length = 60 Score = 52.0 bits (123), Expect = 8e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 81 MPHRTRPMTALLAFMGLNLVLVSTISP 1 MPHRTRPMT+LL FMGLNLVLV+T+SP Sbjct: 1 MPHRTRPMTSLLVFMGLNLVLVNTLSP 27