BLASTX nr result
ID: Ophiopogon25_contig00022682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022682 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65988.1| uncharacterized protein A4U43_C06F3030 [Asparagus... 72 4e-12 >gb|ONK65988.1| uncharacterized protein A4U43_C06F3030 [Asparagus officinalis] Length = 380 Score = 72.4 bits (176), Expect = 4e-12 Identities = 33/62 (53%), Positives = 44/62 (70%) Frame = +3 Query: 3 IFVGDKYSAYMLNDERVKGDCIYFMQPWCDGLRQYKFRMNERSLSYKVICPNLRIGWNGS 182 IFVG+ +A + DERV+G+C+YF+QP DG+R YKF + ERSLSY + P LR W S Sbjct: 314 IFVGECGTACTVKDERVEGNCVYFVQPSYDGMRWYKFSLTERSLSYTLFYPGLRKTWQNS 373 Query: 183 YL 188 +L Sbjct: 374 FL 375