BLASTX nr result
ID: Ophiopogon25_contig00022668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022668 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01893.1| hypothetical protein CDL12_25595 [Handroanthus im... 57 1e-07 dbj|BAS80714.1| Os02g0727966, partial [Oryza sativa Japonica Group] 55 2e-07 gb|PIA45926.1| hypothetical protein AQUCO_01600283v1 [Aquilegia ... 55 3e-07 gb|ESR47270.1| hypothetical protein CICLE_v10003725mg, partial [... 57 4e-07 ref|XP_003597941.1| transmembrane protein, putative [Medicago tr... 55 6e-07 emb|CBI32912.3| unnamed protein product, partial [Vitis vinifera] 54 7e-07 gb|PIA45816.1| hypothetical protein AQUCO_01600212v1 [Aquilegia ... 53 2e-06 ref|XP_007150631.1| hypothetical protein PHAVU_005G168400g [Phas... 54 2e-06 gb|PNR54555.1| hypothetical protein PHYPA_008232, partial [Physc... 52 2e-06 ref|XP_023633781.1| LOW QUALITY PROTEIN: F-box protein At4g27050... 57 3e-06 gb|KQK01935.1| hypothetical protein BRADI_3g59325v3 [Brachypodiu... 52 3e-06 gb|PNR38934.1| hypothetical protein PHYPA_019212, partial [Physc... 52 4e-06 gb|PNR25944.1| hypothetical protein PHYPA_031287, partial [Physc... 52 5e-06 gb|PAN08014.1| hypothetical protein PAHAL_A03244 [Panicum hallii] 52 5e-06 gb|PNR25942.1| hypothetical protein PHYPA_031285, partial [Physc... 52 7e-06 gb|PON50075.1| hypothetical protein PanWU01x14_225170 [Parasponi... 54 7e-06 gb|PNR47652.1| hypothetical protein PHYPA_012125, partial [Physc... 51 8e-06 gb|OQU77506.1| hypothetical protein SORBI_3009G057750 [Sorghum b... 51 9e-06 >gb|PIN01893.1| hypothetical protein CDL12_25595 [Handroanthus impetiginosus] Length = 74 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 289 KQSIPYQSQVSILGPVGYGPTTLPLCHSDFV 197 K ++ YQSQVSILGPVGYGPTTLPL HSDFV Sbjct: 36 KLALSYQSQVSILGPVGYGPTTLPLRHSDFV 66 >dbj|BAS80714.1| Os02g0727966, partial [Oryza sativa Japonica Group] Length = 41 Score = 55.1 bits (131), Expect = 2e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 199 QNQSGTTEAWWAHNPQVPGSKPGSD 273 Q+QSG EAWWAHNPQVPGSKPGSD Sbjct: 16 QHQSGAAEAWWAHNPQVPGSKPGSD 40 >gb|PIA45926.1| hypothetical protein AQUCO_01600283v1 [Aquilegia coerulea] Length = 37 Score = 54.7 bits (130), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 292 NKQSIPYQSQVSILGPVGYGPTTLPLCHSD 203 N +S+ YQSQVSILGPVGYGPTTLPL HSD Sbjct: 8 NSKSLLYQSQVSILGPVGYGPTTLPLRHSD 37 >gb|ESR47270.1| hypothetical protein CICLE_v10003725mg, partial [Citrus clementina] Length = 121 Score = 56.6 bits (135), Expect = 4e-07 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 193 LTQNQSGTTEAWWAHNPQVPGSKPGSD 273 L NQSG EAWWAHNPQVPGSKPGSD Sbjct: 74 LVNNQSGAAEAWWAHNPQVPGSKPGSD 100 >ref|XP_003597941.1| transmembrane protein, putative [Medicago truncatula] gb|AES68192.1| transmembrane protein, putative [Medicago truncatula] Length = 78 Score = 55.1 bits (131), Expect = 6e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 202 NQSGTTEAWWAHNPQVPGSKPGSD 273 NQSG EAWWAHNPQVPGSKPGSD Sbjct: 27 NQSGAAEAWWAHNPQVPGSKPGSD 50 >emb|CBI32912.3| unnamed protein product, partial [Vitis vinifera] Length = 42 Score = 53.9 bits (128), Expect = 7e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 292 NKQSIPYQSQVSILGPVGYGPTTLPLCHSDFVL 194 N S+ YQSQVSILGPVGYGPTTLPL HSD ++ Sbjct: 8 NILSLTYQSQVSILGPVGYGPTTLPLRHSDLLV 40 >gb|PIA45816.1| hypothetical protein AQUCO_01600212v1 [Aquilegia coerulea] Length = 59 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -2 Query: 274 YQSQVSILGPVGYGPTTLPLCHSDFVLV 191 YQSQVSILGPVGYGPTTLPL HSD +++ Sbjct: 26 YQSQVSILGPVGYGPTTLPLRHSDLLII 53 >ref|XP_007150631.1| hypothetical protein PHAVU_005G168400g [Phaseolus vulgaris] gb|ESW22625.1| hypothetical protein PHAVU_005G168400g [Phaseolus vulgaris] Length = 104 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 197 HKIRVAQRKRGGPITHRSQDRNLALI 274 H+IRVAQRKRGGPITHRSQDRNLALI Sbjct: 24 HQIRVAQRKRGGPITHRSQDRNLALI 49 >gb|PNR54555.1| hypothetical protein PHYPA_008232, partial [Physcomitrella patens] Length = 34 Score = 52.4 bits (124), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 283 SIPYQSQVSILGPVGYGPTTLPLCHSDFVLV 191 S+ YQS+VSILGP+GYGPTTLPL HSD +++ Sbjct: 3 SLKYQSEVSILGPMGYGPTTLPLRHSDGIII 33 >ref|XP_023633781.1| LOW QUALITY PROTEIN: F-box protein At4g27050 [Capsella rubella] Length = 375 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 273 IRARFRSWDLWVMGPPRFRCATLI 202 IRARFRSWDLWVMGPPRFRCATLI Sbjct: 351 IRARFRSWDLWVMGPPRFRCATLI 374 >gb|KQK01935.1| hypothetical protein BRADI_3g59325v3 [Brachypodium distachyon] Length = 33 Score = 52.0 bits (123), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 289 KQSIPYQSQVSILGPVGYGPTTLPLCHSD 203 ++S YQSQVSILGPVGYGPTTLPL HSD Sbjct: 2 QRSTNYQSQVSILGPVGYGPTTLPLRHSD 30 >gb|PNR38934.1| hypothetical protein PHYPA_019212, partial [Physcomitrella patens] Length = 41 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 197 HKIRVAQRKRGGPITHRSQDRNLALI 274 H IRVAQRKRGGPITHRS DRNLALI Sbjct: 3 HNIRVAQRKRGGPITHRSDDRNLALI 28 >gb|PNR25944.1| hypothetical protein PHYPA_031287, partial [Physcomitrella patens] Length = 40 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +2 Query: 200 KIRVAQRKRGGPITHRSQDRNLALI 274 KIRVAQRKRGGPITHRS+DRNLALI Sbjct: 9 KIRVAQRKRGGPITHRSEDRNLALI 33 >gb|PAN08014.1| hypothetical protein PAHAL_A03244 [Panicum hallii] Length = 41 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -2 Query: 289 KQSIPYQSQVSILGPVGYGPTTLPLCHSD 203 + S YQSQVSILGPVGYGPTTLPL HSD Sbjct: 3 RSSEDYQSQVSILGPVGYGPTTLPLRHSD 31 >gb|PNR25942.1| hypothetical protein PHYPA_031285, partial [Physcomitrella patens] gb|PNR25946.1| hypothetical protein PHYPA_031289, partial [Physcomitrella patens] Length = 55 Score = 51.6 bits (122), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +2 Query: 200 KIRVAQRKRGGPITHRSQDRNLALI 274 KIRVAQRKRGGPITHRS+DRNLALI Sbjct: 31 KIRVAQRKRGGPITHRSEDRNLALI 55 >gb|PON50075.1| hypothetical protein PanWU01x14_225170 [Parasponia andersonii] Length = 132 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -1 Query: 281 NTISEPGFDPGTCGLWAHHASVVPL 207 ++ISEPGFDPGTCGLWAHHAS PL Sbjct: 108 SSISEPGFDPGTCGLWAHHASAAPL 132 >gb|PNR47652.1| hypothetical protein PHYPA_012125, partial [Physcomitrella patens] Length = 31 Score = 50.8 bits (120), Expect = 8e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -2 Query: 283 SIPYQSQVSILGPVGYGPTTLPLCHSD 203 S+ YQS+VSILGPVGYGPTTLPL HSD Sbjct: 3 SLYYQSEVSILGPVGYGPTTLPLRHSD 29 >gb|OQU77506.1| hypothetical protein SORBI_3009G057750 [Sorghum bicolor] Length = 34 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 274 YQSQVSILGPVGYGPTTLPLCHSD 203 YQSQVSILGPVGYGPTTLPL HSD Sbjct: 7 YQSQVSILGPVGYGPTTLPLRHSD 30