BLASTX nr result
ID: Ophiopogon25_contig00022597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022597 (1076 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI54651.1| hypothetical protein CRG98_024936 [Punica granatum] 57 4e-06 >gb|PKI54651.1| hypothetical protein CRG98_024936 [Punica granatum] Length = 174 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 94 VDMATSCYEHACVKYPNNLGIIMVLFNCYVR 2 +D+ATSCYEHAC K+PNNL ++M LFNCYVR Sbjct: 102 LDLATSCYEHACGKFPNNLDLMMGLFNCYVR 132