BLASTX nr result
ID: Ophiopogon25_contig00022554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022554 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796709.1| PREDICTED: putative nuclear RNA export facto... 57 7e-07 ref|XP_008796708.1| PREDICTED: putative nuclear RNA export facto... 57 7e-07 ref|XP_010918486.1| PREDICTED: putative nuclear RNA export facto... 54 8e-06 >ref|XP_008796709.1| PREDICTED: putative nuclear RNA export factor SDE5 isoform X2 [Phoenix dactylifera] Length = 295 Score = 56.6 bits (135), Expect = 7e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +1 Query: 1 LLEKESIQWVEEEGNPGTIRISLDTIDPKKLSFVNDSQ 114 LLEKESI+W EEEG PGT I LD IDP KLSFV S+ Sbjct: 258 LLEKESIKWTEEEGKPGTYLIQLDLIDPNKLSFVKVSE 295 >ref|XP_008796708.1| PREDICTED: putative nuclear RNA export factor SDE5 isoform X1 [Phoenix dactylifera] Length = 297 Score = 56.6 bits (135), Expect = 7e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +1 Query: 1 LLEKESIQWVEEEGNPGTIRISLDTIDPKKLSFVNDSQ 114 LLEKESI+W EEEG PGT I LD IDP KLSFV S+ Sbjct: 260 LLEKESIKWTEEEGKPGTYLIQLDLIDPNKLSFVKVSE 297 >ref|XP_010918486.1| PREDICTED: putative nuclear RNA export factor SDE5 [Elaeis guineensis] Length = 497 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 4 LEKESIQWVEEEGNPGTIRISLDTIDPKKLSFVNDSQ 114 LEKESI+W EEEG PGT I LD IDP KL+FV S+ Sbjct: 461 LEKESIKWAEEEGKPGTYLIQLDQIDPNKLNFVKVSE 497