BLASTX nr result
ID: Ophiopogon25_contig00022485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022485 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241451.1| protein SUPPRESSOR OF GENE SILENCING 3 homol... 57 1e-06 ref|XP_008786464.1| PREDICTED: protein SUPPRESSOR OF GENE SILENC... 55 5e-06 >ref|XP_020241451.1| protein SUPPRESSOR OF GENE SILENCING 3 homolog [Asparagus officinalis] gb|ONK59455.1| uncharacterized protein A4U43_C08F6600 [Asparagus officinalis] Length = 656 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -3 Query: 220 DQLKRDMADINLDSAQESEWEVIAKKSENMALANAKPWDSSTVAPSA 80 DQL R +AD ++DS +E WEV+A+KS+N A++NA+PW SSTV +A Sbjct: 44 DQLNRKVADTHIDSTEEG-WEVVARKSKNQAVSNAEPWGSSTVTHNA 89 >ref|XP_008786464.1| PREDICTED: protein SUPPRESSOR OF GENE SILENCING 3 homolog [Phoenix dactylifera] Length = 662 Score = 55.1 bits (131), Expect = 5e-06 Identities = 31/51 (60%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -3 Query: 220 DQLKRDMADINLDSAQESEWEVIAKKSENMALAN----AKPWDSSTVAPSA 80 DQL RDMADI++D+ QE WEV AKKS+N A A AKPW SS AP A Sbjct: 42 DQLSRDMADISVDT-QEGGWEVYAKKSKNRAGAGAGTAAKPWGSSNTAPKA 91