BLASTX nr result
ID: Ophiopogon25_contig00022479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022479 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022758409.1| mitochondrial import inner membrane transloc... 61 1e-08 ref|XP_021632392.1| mitochondrial import inner membrane transloc... 61 2e-08 ref|XP_021632393.1| mitochondrial import inner membrane transloc... 61 2e-08 ref|XP_008346094.1| PREDICTED: mitochondrial import inner membra... 58 3e-08 gb|PKI31083.1| hypothetical protein CRG98_048529, partial [Punic... 59 4e-08 ref|XP_010911925.1| PREDICTED: mitochondrial import inner membra... 60 4e-08 ref|XP_010911926.1| PREDICTED: mitochondrial import inner membra... 60 4e-08 ref|XP_019704246.1| PREDICTED: mitochondrial import inner membra... 60 4e-08 gb|PPR93621.1| hypothetical protein GOBAR_AA27059 [Gossypium bar... 59 6e-08 ref|XP_016714082.1| PREDICTED: mitochondrial import inner membra... 59 6e-08 ref|XP_021280520.1| mitochondrial import inner membrane transloc... 61 8e-08 ref|XP_007050298.2| PREDICTED: mitochondrial import inner membra... 61 8e-08 gb|EOX94455.1| Translocase inner membrane subunit 44-2 isoform 1... 61 8e-08 ref|XP_020260466.1| mitochondrial import inner membrane transloc... 59 8e-08 ref|XP_021280521.1| mitochondrial import inner membrane transloc... 61 8e-08 gb|EOX94456.1| Translocase inner membrane subunit 44-2 isoform 2... 61 8e-08 ref|XP_008785775.1| PREDICTED: mitochondrial import inner membra... 60 1e-07 ref|XP_017697598.1| PREDICTED: mitochondrial import inner membra... 60 1e-07 ref|XP_022771262.1| mitochondrial import inner membrane transloc... 61 1e-07 gb|OMP09020.1| Membrane transporter, Tim44-related/Ribosomal pro... 59 1e-07 >ref|XP_022758409.1| mitochondrial import inner membrane translocase subunit TIM44-2-like [Durio zibethinus] Length = 476 Score = 60.8 bits (146), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 423 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 463 Score = 25.8 bits (55), Expect(2) = 1e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQALI Sbjct: 465 REMQQIGVQALI 476 >ref|XP_021632392.1| mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X1 [Manihot esculenta] gb|OAY32643.1| hypothetical protein MANES_13G034400 [Manihot esculenta] Length = 483 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 414 CDREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 CDR G++T+G KDTIHT+ YAWAM+Q+ E GEG +YP +K Sbjct: 429 CDRNGAVTEGGKDTIHTVYYAWAMQQLDPEELGEGAIYPIWK 470 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQVG+QALI Sbjct: 472 REMQQVGLQALI 483 >ref|XP_021632393.1| mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X2 [Manihot esculenta] ref|XP_021632394.1| mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X2 [Manihot esculenta] Length = 401 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 414 CDREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 CDR G++T+G KDTIHT+ YAWAM+Q+ E GEG +YP +K Sbjct: 347 CDRNGAVTEGGKDTIHTVYYAWAMQQLDPEELGEGAIYPIWK 388 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQVG+QALI Sbjct: 390 REMQQVGLQALI 401 >ref|XP_008346094.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-1-like [Malus domestica] Length = 75 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR G +TDG KDTIHT+ YAWAM+Q+ E GEG +YP +K Sbjct: 22 DRNGDVTDGGKDTIHTVYYAWAMQQVDPEELGEGAIYPIWK 62 >gb|PKI31083.1| hypothetical protein CRG98_048529, partial [Punica granatum] Length = 123 Score = 59.3 bits (142), Expect = 4e-08 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 444 DSKHGRSIVSC--DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 D+K V C DR G++T+G KDTIHT+ YAWAM+Q+ E GEG LYP +K Sbjct: 57 DNKFQTQQVYCVRDRNGAVTEGGKDTIHTVYYAWAMQQVDPEELGEGALYPVWK 110 >ref|XP_010911925.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2 isoform X1 [Elaeis guineensis] Length = 483 Score = 60.1 bits (144), Expect(2) = 4e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR+GSIT G KDTIHTI YAWAM+QM +E GEG YP +K Sbjct: 430 DRQGSITAGGKDTIHTIYYAWAMQQMDVEELGEGAYYPVWK 470 Score = 25.0 bits (53), Expect(2) = 4e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQALI Sbjct: 472 REMQQLGVQALI 483 >ref|XP_010911926.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2 isoform X2 [Elaeis guineensis] Length = 460 Score = 60.1 bits (144), Expect(2) = 4e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR+GSIT G KDTIHTI YAWAM+QM +E GEG YP +K Sbjct: 407 DRQGSITAGGKDTIHTIYYAWAMQQMDVEELGEGAYYPVWK 447 Score = 25.0 bits (53), Expect(2) = 4e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQALI Sbjct: 449 REMQQLGVQALI 460 >ref|XP_019704246.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2 isoform X3 [Elaeis guineensis] Length = 410 Score = 60.1 bits (144), Expect(2) = 4e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR+GSIT G KDTIHTI YAWAM+QM +E GEG YP +K Sbjct: 357 DRQGSITAGGKDTIHTIYYAWAMQQMDVEELGEGAYYPVWK 397 Score = 25.0 bits (53), Expect(2) = 4e-08 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQALI Sbjct: 399 REMQQLGVQALI 410 >gb|PPR93621.1| hypothetical protein GOBAR_AA27059 [Gossypium barbadense] Length = 490 Score = 58.9 bits (141), Expect(2) = 6e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 +REG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 437 NREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 477 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+G+QALI Sbjct: 479 REMQQIGIQALI 490 >ref|XP_016714082.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like [Gossypium hirsutum] ref|XP_017623834.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2 [Gossypium arboreum] gb|KHG20040.1| Mitochondrial import inner membrane translocase subunit TIM44 [Gossypium arboreum] Length = 475 Score = 58.9 bits (141), Expect(2) = 6e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 +REG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 422 NREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 462 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+G+QALI Sbjct: 464 REMQQIGIQALI 475 >ref|XP_021280520.1| mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X1 [Herrania umbratica] Length = 476 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 423 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 463 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQ +GVQALI Sbjct: 465 REMQLIGVQALI 476 >ref|XP_007050298.2| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2 [Theobroma cacao] Length = 476 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 423 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 463 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQ +GVQALI Sbjct: 465 REMQLIGVQALI 476 >gb|EOX94455.1| Translocase inner membrane subunit 44-2 isoform 1 [Theobroma cacao] Length = 476 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 423 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 463 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQ +GVQALI Sbjct: 465 REMQLIGVQALI 476 >ref|XP_020260466.1| mitochondrial import inner membrane translocase subunit TIM44-2 [Asparagus officinalis] gb|ONK71371.1| uncharacterized protein A4U43_C04F7860 [Asparagus officinalis] Length = 466 Score = 59.3 bits (142), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREGSITDG KDTIHT+ YAWAM+Q+ + GE LYP +K Sbjct: 413 DREGSITDGGKDTIHTVYYAWAMQQIDAQELGEDALYPIWK 453 Score = 24.6 bits (52), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+G+QALI Sbjct: 455 REMQQIGMQALI 466 >ref|XP_021280521.1| mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X2 [Herrania umbratica] Length = 442 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 389 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 429 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQ +GVQALI Sbjct: 431 REMQLIGVQALI 442 >gb|EOX94456.1| Translocase inner membrane subunit 44-2 isoform 2 [Theobroma cacao] Length = 365 Score = 60.8 bits (146), Expect(2) = 8e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 312 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 352 Score = 23.1 bits (48), Expect(2) = 8e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQ +GVQALI Sbjct: 354 REMQLIGVQALI 365 >ref|XP_008785775.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X1 [Phoenix dactylifera] ref|XP_008785778.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X1 [Phoenix dactylifera] ref|XP_008785779.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X1 [Phoenix dactylifera] Length = 483 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR+GSIT G KDTIHT+ YAWAM+QM +E GEG YP +K Sbjct: 430 DRQGSITAGGKDTIHTVYYAWAMQQMDVEELGEGAYYPVWK 470 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQ+LI Sbjct: 472 REMQQLGVQSLI 483 >ref|XP_017697598.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM44-2-like isoform X2 [Phoenix dactylifera] Length = 453 Score = 59.7 bits (143), Expect(2) = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DR+GSIT G KDTIHT+ YAWAM+QM +E GEG YP +K Sbjct: 400 DRQGSITAGGKDTIHTVYYAWAMQQMDVEELGEGAYYPVWK 440 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+GVQ+LI Sbjct: 442 REMQQLGVQSLI 453 >ref|XP_022771262.1| mitochondrial import inner membrane translocase subunit TIM44-2-like [Durio zibethinus] ref|XP_022771263.1| mitochondrial import inner membrane translocase subunit TIM44-2-like [Durio zibethinus] Length = 474 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G KDTIHT+ YAWAM+Q+ +E GEG LYP +K Sbjct: 421 DREGKITEGGKDTIHTVYYAWAMQQVDVEELGEGALYPIWK 461 >gb|OMP09020.1| Membrane transporter, Tim44-related/Ribosomal protein L45 [Corchorus olitorius] Length = 485 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 411 DREGSITDGCKDTIHTINYAWAMRQMAMEVHGEGTLYPEYK 289 DREG IT+G +DTIHT+ YAWAM+Q+ +E GEG +YP +K Sbjct: 432 DREGKITEGGQDTIHTVYYAWAMQQVDVEELGEGAIYPIWK 472 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 289 REMQQVGVQALI 254 REMQQ+G+QALI Sbjct: 474 REMQQMGIQALI 485