BLASTX nr result
ID: Ophiopogon25_contig00022357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022357 (969 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011018187.1| PREDICTED: FGGY carbohydrate kinase domain-c... 59 6e-06 >ref|XP_011018187.1| PREDICTED: FGGY carbohydrate kinase domain-containing protein isoform X2 [Populus euphratica] Length = 575 Score = 58.9 bits (141), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 3 CRTSTCHVAVSRNKLFIPGIWGAFWSGIKSF 95 C TSTCH+AVSRNKLFIPG+WG FWS I F Sbjct: 350 CGTSTCHMAVSRNKLFIPGVWGPFWSEISMF 380