BLASTX nr result
ID: Ophiopogon25_contig00022352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022352 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255649.1| pentatricopeptide repeat-containing protein ... 62 2e-08 ref|XP_010905942.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-07 ref|XP_021284721.1| pentatricopeptide repeat-containing protein ... 57 9e-07 ref|XP_007018892.2| PREDICTED: pentatricopeptide repeat-containi... 57 9e-07 gb|EOY16117.1| Pentatricopeptide repeat (PPR) superfamily protei... 57 9e-07 ref|XP_008801054.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_020547795.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 57 1e-06 gb|OAY72053.1| Pentatricopeptide repeat-containing protein [Anan... 57 1e-06 ref|XP_020110207.1| pentatricopeptide repeat-containing protein ... 57 2e-06 gb|OMO94142.1| hypothetical protein COLO4_16506 [Corchorus olito... 57 2e-06 ref|XP_020695192.1| pentatricopeptide repeat-containing protein ... 56 2e-06 ref|XP_022744599.1| pentatricopeptide repeat-containing protein ... 56 3e-06 ref|XP_011083953.1| pentatricopeptide repeat-containing protein ... 55 4e-06 ref|XP_024168702.1| pentatricopeptide repeat-containing protein ... 55 4e-06 ref|XP_011083951.1| pentatricopeptide repeat-containing protein ... 55 4e-06 dbj|GAY41681.1| hypothetical protein CUMW_061280 [Citrus unshiu] 55 5e-06 gb|KZV28928.1| pentatricopeptide repeat-containing protein-like ... 55 6e-06 gb|PKA51590.1| Pentatricopeptide repeat-containing protein [Apos... 55 6e-06 gb|KDO80855.1| hypothetical protein CISIN_1g007052mg [Citrus sin... 55 6e-06 ref|XP_006472673.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_020255649.1| pentatricopeptide repeat-containing protein At4g18520-like [Asparagus officinalis] gb|ONK73983.1| uncharacterized protein A4U43_C03F1590 [Asparagus officinalis] Length = 605 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EALQLMYRMQ +GFYVDDFVL TVL C D QWE Sbjct: 558 CREALQLMYRMQKEGFYVDDFVLSTVLGSCGDLQWE 593 >ref|XP_010905942.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520 [Elaeis guineensis] Length = 616 Score = 57.4 bits (137), Expect = 9e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQ +G YVDDFV TVLS C D QWE Sbjct: 569 CREALRLMYRMQEEGLYVDDFVHATVLSACGDIQWE 604 >ref|XP_021284721.1| pentatricopeptide repeat-containing protein At4g18520, chloroplastic [Herrania umbratica] Length = 620 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EALQLMYRM+A+GF VDD++L TVLS C D +W+ Sbjct: 574 CREALQLMYRMEAEGFEVDDYILTTVLSACGDIEWD 609 >ref|XP_007018892.2| PREDICTED: pentatricopeptide repeat-containing protein At4g18520 [Theobroma cacao] Length = 620 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EALQLMYRM+A+GF VDD++L TVLS C D +W+ Sbjct: 574 CREALQLMYRMEAEGFEVDDYILTTVLSACGDIEWD 609 >gb|EOY16117.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 620 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EALQLMYRM+A+GF VDD++L TVLS C D +W+ Sbjct: 574 CREALQLMYRMEAEGFEVDDYILTTVLSACGDIEWD 609 >ref|XP_008801054.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520 [Phoenix dactylifera] Length = 616 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQ +G YVDDFV TVLS C D QWE Sbjct: 569 CREALKLMYRMQEEGLYVDDFVHATVLSVCGDIQWE 604 >ref|XP_020547795.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g18520-like [Sesamum indicum] Length = 619 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQA+G VDD+VL TVL+ C DF+WE Sbjct: 574 CSEALKLMYRMQAEGIEVDDYVLSTVLTTCGDFKWE 609 >gb|OAY72053.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 296 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQ +GF VD+FVL TVLS C D QWE Sbjct: 242 CKEALKLMYRMQEEGFDVDNFVLATVLSACGDVQWE 277 >ref|XP_020110207.1| pentatricopeptide repeat-containing protein At4g18520-like [Ananas comosus] Length = 577 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQ +GF VD+FVL TVLS C D QWE Sbjct: 523 CKEALKLMYRMQEEGFDVDNFVLATVLSACGDVQWE 558 >gb|OMO94142.1| hypothetical protein COLO4_16506 [Corchorus olitorius] Length = 621 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EALQLMYRM+A+GF VDD++L TVL+ C D +W+ Sbjct: 575 CQEALQLMYRMEAEGFEVDDYILATVLTACGDIEWD 610 >ref|XP_020695192.1| pentatricopeptide repeat-containing protein At4g18520-like [Dendrobium catenatum] gb|PKU71466.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 615 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDF 188 C EA++LMYRMQA+GF+VDDF+L TVLS C DF Sbjct: 568 CEEAMKLMYRMQAEGFHVDDFILTTVLSSCGDF 600 >ref|XP_022744599.1| pentatricopeptide repeat-containing protein At4g18520, chloroplastic-like [Durio zibethinus] Length = 620 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRM+A+GF VDD++L TVLS C D +W+ Sbjct: 574 CREALKLMYRMEAEGFEVDDYILTTVLSACGDIEWD 609 >ref|XP_011083953.1| pentatricopeptide repeat-containing protein At4g18520-like isoform X2 [Sesamum indicum] Length = 470 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQA+G VDD++L TVL+ C DF+W+ Sbjct: 425 CSEALKLMYRMQAEGIEVDDYILSTVLTTCGDFEWK 460 >ref|XP_024168702.1| pentatricopeptide repeat-containing protein At4g18520, chloroplastic-like [Rosa chinensis] gb|PRQ21541.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 616 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQA+GF +DD++L TVL+ C D +W+ Sbjct: 569 CQEALKLMYRMQAEGFQLDDYILATVLTACGDIEWD 604 >ref|XP_011083951.1| pentatricopeptide repeat-containing protein At4g18520-like isoform X1 [Sesamum indicum] ref|XP_011083952.1| pentatricopeptide repeat-containing protein At4g18520-like isoform X1 [Sesamum indicum] Length = 618 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+LMYRMQA+G VDD++L TVL+ C DF+W+ Sbjct: 573 CSEALKLMYRMQAEGIEVDDYILSTVLTTCGDFEWK 608 >dbj|GAY41681.1| hypothetical protein CUMW_061280 [Citrus unshiu] Length = 472 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -3 Query: 364 NDEEFDLGTIQARIEGFRHRKWSECCCPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQ 185 N E +L T ++ I G+ C EAL+LMYRMQA+GF VDD++L+TV + C D + Sbjct: 403 NMPERNLFTWKSMIVGYARNG----LCQEALKLMYRMQAEGFEVDDYILITVYNACGDIE 458 Query: 184 W 182 W Sbjct: 459 W 459 >gb|KZV28928.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 575 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQWE 179 C EAL+L+Y MQA+G VDDF+L TVLS C DF+W+ Sbjct: 529 CDEALRLVYHMQAEGIEVDDFILSTVLSSCGDFEWD 564 >gb|PKA51590.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 609 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 286 CPEALQLMYRMQAKGFYVDDFVLLTVLSECRDF 188 C +AL+LMYRMQA+GF+VDDF+L TVLS C DF Sbjct: 562 CHKALKLMYRMQAEGFHVDDFILTTVLSSCGDF 594 >gb|KDO80855.1| hypothetical protein CISIN_1g007052mg [Citrus sinensis] Length = 620 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -3 Query: 364 NDEEFDLGTIQARIEGFRHRKWSECCCPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQ 185 N E +L T ++ I G+ C EAL+LMYRMQA+GF VDD++L+TV + C D + Sbjct: 551 NMPERNLFTWKSMIVGYARNG----LCQEALKLMYRMQAEGFEVDDYILITVYNACGDIE 606 Query: 184 W 182 W Sbjct: 607 W 607 >ref|XP_006472673.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520 [Citrus sinensis] Length = 620 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -3 Query: 364 NDEEFDLGTIQARIEGFRHRKWSECCCPEALQLMYRMQAKGFYVDDFVLLTVLSECRDFQ 185 N E +L T ++ I G+ C EAL+LMYRMQA+GF VDD++L+TV + C D + Sbjct: 551 NMPERNLFTWKSMIVGYARNG----LCQEALKLMYRMQAEGFEVDDYILITVYNACGDIE 606 Query: 184 W 182 W Sbjct: 607 W 607