BLASTX nr result
ID: Ophiopogon25_contig00022266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022266 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57393.1| uncharacterized protein A4U43_C09F60 [Asparagus o... 98 1e-21 >gb|ONK57393.1| uncharacterized protein A4U43_C09F60 [Asparagus officinalis] Length = 329 Score = 98.2 bits (243), Expect = 1e-21 Identities = 51/73 (69%), Positives = 57/73 (78%), Gaps = 1/73 (1%) Frame = +1 Query: 1 HLGSGNYASRDLKAQVYGNVVDSTRDLSIGVGNASGRDNNLIVRDNEF-RGRHGSVDIGV 177 HL S N A RD +A+VYGNVVD T DLSI GN SGRD +L VRDN+F RG GSV+IGV Sbjct: 118 HLASENSACRDFRARVYGNVVDPTHDLSISAGNVSGRDADLTVRDNDFLRGGQGSVNIGV 177 Query: 178 GNQSGGPLKIVVA 216 GNQSGG +KIVVA Sbjct: 178 GNQSGGAIKIVVA 190