BLASTX nr result
ID: Ophiopogon25_contig00022216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022216 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975... 56 9e-07 >ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975481 [Musa acuminata subsp. malaccensis] Length = 142 Score = 56.2 bits (134), Expect = 9e-07 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -1 Query: 271 CCSRSGRGPDKTMKAPGGRGAVIKRASFEEDPRSYYRNLRGKEE 140 CC RG + M+APG GAV+ RASFE DPR Y+ NLR K++ Sbjct: 96 CCGGGSRGTGRMMRAPGRHGAVMPRASFESDPRGYFINLRAKKD 139