BLASTX nr result
ID: Ophiopogon25_contig00022078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00022078 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254341.1| pentatricopeptide repeat-containing protein ... 57 4e-07 gb|ONK78743.1| uncharacterized protein A4U43_C02F21960 [Asparagu... 57 4e-07 ref|XP_022680713.1| pentatricopeptide repeat-containing protein ... 54 7e-06 >ref|XP_020254341.1| pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Asparagus officinalis] Length = 772 Score = 57.0 bits (136), Expect(2) = 4e-07 Identities = 32/58 (55%), Positives = 38/58 (65%) Frame = -2 Query: 463 VEALLKSIGAXXXXXXXXXXXNWFVSPGSVIATWLRDYSTISILLLRDERIQIARPTN 290 +E+LLKSIGA FVSP +VIA+WLR+ TISILLLRDER + A P N Sbjct: 707 IESLLKSIGAPFQLERFNIGR--FVSPSAVIASWLRESGTISILLLRDERTRTANPEN 762 Score = 24.6 bits (52), Expect(2) = 4e-07 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 512 ILTGLGKHSKIV 477 ILTG GKHSK+V Sbjct: 687 ILTGWGKHSKVV 698 >gb|ONK78743.1| uncharacterized protein A4U43_C02F21960 [Asparagus officinalis] Length = 586 Score = 57.0 bits (136), Expect(2) = 4e-07 Identities = 32/58 (55%), Positives = 38/58 (65%) Frame = -2 Query: 463 VEALLKSIGAXXXXXXXXXXXNWFVSPGSVIATWLRDYSTISILLLRDERIQIARPTN 290 +E+LLKSIGA FVSP +VIA+WLR+ TISILLLRDER + A P N Sbjct: 521 IESLLKSIGAPFQLERFNIGR--FVSPSAVIASWLRESGTISILLLRDERTRTANPEN 576 Score = 24.6 bits (52), Expect(2) = 4e-07 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 512 ILTGLGKHSKIV 477 ILTG GKHSK+V Sbjct: 501 ILTGWGKHSKVV 512 >ref|XP_022680713.1| pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Setaria italica] gb|KQL16599.1| hypothetical protein SETIT_021190mg [Setaria italica] Length = 867 Score = 53.9 bits (128), Expect(2) = 7e-06 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = -2 Query: 463 VEALLKSIGAXXXXXXXXXXXNWFVSPGSVIATWLRDYSTISILLLRDERIQIARPTN 290 +EALL SIGA FVSP +V+A WLR+ TI+ILLLR+ER+Q A P N Sbjct: 802 IEALLLSIGAPFQVERFNIGR--FVSPSAVVAAWLRESGTINILLLRNERVQHANPPN 857 Score = 23.5 bits (49), Expect(2) = 7e-06 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 512 ILTGLGKHSKI 480 ILTG GKHSKI Sbjct: 782 ILTGWGKHSKI 792