BLASTX nr result
ID: Ophiopogon25_contig00021990
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00021990 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269192.1| pentatricopeptide repeat-containing protein ... 73 2e-12 ref|XP_020269191.1| pentatricopeptide repeat-containing protein ... 73 2e-12 gb|ONK65919.1| uncharacterized protein A4U43_C06F2340 [Asparagus... 73 2e-12 gb|ESR65411.1| hypothetical protein CICLE_v10008545mg [Citrus cl... 64 3e-09 gb|KDO52945.1| hypothetical protein CISIN_1g012365mg [Citrus sin... 64 3e-09 ref|XP_015384761.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_006452171.2| LOW QUALITY PROTEIN: pentatricopeptide repea... 64 3e-09 gb|KZV27243.1| pentatricopeptide repeat-containing protein mitoc... 63 4e-09 ref|XP_020674911.1| pentatricopeptide repeat-containing protein ... 63 6e-09 ref|XP_020593997.1| pentatricopeptide repeat-containing protein ... 62 9e-09 ref|XP_020593996.1| pentatricopeptide repeat-containing protein ... 62 9e-09 ref|XP_008365978.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-08 ref|XP_011097923.1| pentatricopeptide repeat-containing protein ... 59 1e-07 ref|XP_011469581.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_011469580.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_011469578.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_009343089.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_009343088.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_009358101.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 gb|OEL36115.1| Pentatricopeptide repeat-containing protein [Dich... 58 4e-07 >ref|XP_020269192.1| pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X2 [Asparagus officinalis] Length = 729 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMYEALL SG +KASKLLKK+ KDDPHV YII+SC+ TF+KPS+ Sbjct: 683 LRMYEALLVSGQRKKASKLLKKIEKDDPHVNYIIKSCKETFMKPSS 728 >ref|XP_020269191.1| pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X1 [Asparagus officinalis] Length = 730 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMYEALL SG +KASKLLKK+ KDDPHV YII+SC+ TF+KPS+ Sbjct: 684 LRMYEALLVSGQRKKASKLLKKIEKDDPHVNYIIKSCKETFMKPSS 729 >gb|ONK65919.1| uncharacterized protein A4U43_C06F2340 [Asparagus officinalis] Length = 775 Score = 72.8 bits (177), Expect = 2e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMYEALL SG +KASKLLKK+ KDDPHV YII+SC+ TF+KPS+ Sbjct: 729 LRMYEALLVSGQRKKASKLLKKIEKDDPHVNYIIKSCKETFMKPSS 774 >gb|ESR65411.1| hypothetical protein CICLE_v10008545mg [Citrus clementina] Length = 395 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPSTT*ER 150 L MY+A LASG + ASKLL KMPKDDPHV+++IQ+C+ T+ PS ER Sbjct: 330 LWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTYTIPSLQKER 379 >gb|KDO52945.1| hypothetical protein CISIN_1g012365mg [Citrus sinensis] Length = 465 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPSTT*ER 150 L MY+A LASG + ASKLL KMPKDDPHV+++IQ+C+ T+ PS ER Sbjct: 400 LWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTYTIPSLQKER 449 >ref|XP_015384761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Citrus sinensis] ref|XP_015384762.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Citrus sinensis] Length = 743 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPSTT*ER 150 L MY+A LASG + ASKLL KMPKDDPHV+++IQ+C+ T+ PS ER Sbjct: 678 LWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTYTIPSLQKER 727 >ref|XP_006452171.2| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Citrus clementina] Length = 888 Score = 63.5 bits (153), Expect = 3e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPSTT*ER 150 L MY+A LASG + ASKLL KMPKDDPHV+++IQ+C+ T+ PS ER Sbjct: 823 LWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTYTIPSLQKER 872 >gb|KZV27243.1| pentatricopeptide repeat-containing protein mitochondrial-like [Dorcoceras hygrometricum] Length = 291 Score = 62.8 bits (151), Expect = 4e-09 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKP 132 +RMY+ALLASG A+K+LKK+PKDDPHV +IQ+C+ T++KP Sbjct: 199 VRMYQALLASGERASAAKILKKIPKDDPHVLCVIQACQETYLKP 242 >ref|XP_020674911.1| pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like [Dendrobium catenatum] gb|PKU85832.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 412 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIK 129 LRMY+ALLAS + +AS +LK++ KDDPHV+YII+SC+AT+ K Sbjct: 361 LRMYQALLASDEINEASNILKRITKDDPHVRYIIESCKATYCK 403 >ref|XP_020593997.1| pentatricopeptide repeat-containing protein At4g04790, mitochondrial isoform X2 [Phalaenopsis equestris] Length = 829 Score = 62.4 bits (150), Expect = 9e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATF 123 LRMY+ALLASG + AS +LK++ KDDPHV+Y+I+SC+AT+ Sbjct: 778 LRMYQALLASGDINAASNILKRITKDDPHVRYVIESCKATY 818 >ref|XP_020593996.1| pentatricopeptide repeat-containing protein At4g04790, mitochondrial isoform X1 [Phalaenopsis equestris] Length = 837 Score = 62.4 bits (150), Expect = 9e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATF 123 LRMY+ALLASG + AS +LK++ KDDPHV+Y+I+SC+AT+ Sbjct: 786 LRMYQALLASGDINAASNILKRITKDDPHVRYVIESCKATY 826 >ref|XP_008365978.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Malus domestica] Length = 209 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMY+ALLA G A L KMPKDDPHV+YIIQ+C+ + KP + Sbjct: 158 LRMYQALLAGGDRNAARNLHAKMPKDDPHVRYIIQACKTAYPKPKS 203 >ref|XP_011097923.1| pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Sesamum indicum] Length = 904 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIK 129 LRMY+ALLASG + A+K+L KMPKDDPHV+ + ++C T+IK Sbjct: 838 LRMYQALLASGDRQSAAKILSKMPKDDPHVRCVAKACENTYIK 880 >ref|XP_011469581.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X3 [Fragaria vesca subsp. vesca] Length = 799 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/44 (68%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLK-KMPKDDPHVQYIIQSCRATFIK 129 LRMY+ALLASG RKA+K+L+ K+PKDDPHVQ II++C+ T+IK Sbjct: 737 LRMYQALLASGD-RKAAKVLEHKIPKDDPHVQSIIEACKQTYIK 779 >ref|XP_011469580.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X2 [Fragaria vesca subsp. vesca] Length = 810 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/44 (68%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLK-KMPKDDPHVQYIIQSCRATFIK 129 LRMY+ALLASG RKA+K+L+ K+PKDDPHVQ II++C+ T+IK Sbjct: 748 LRMYQALLASGD-RKAAKVLEHKIPKDDPHVQSIIEACKQTYIK 790 >ref|XP_011469578.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X1 [Fragaria vesca subsp. vesca] ref|XP_011469579.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like isoform X1 [Fragaria vesca subsp. vesca] Length = 811 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/44 (68%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLK-KMPKDDPHVQYIIQSCRATFIK 129 LRMY+ALLASG RKA+K+L+ K+PKDDPHVQ II++C+ T+IK Sbjct: 749 LRMYQALLASGD-RKAAKVLEHKIPKDDPHVQSIIEACKQTYIK 791 >ref|XP_009343089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 844 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMY+ALLA G + A L KMPKDDPHV+YIIQ+C+ + +P + Sbjct: 793 LRMYQALLAGGDRKAARTLRGKMPKDDPHVRYIIQACKTAYSEPKS 838 >ref|XP_009343088.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Pyrus x bretschneideri] Length = 845 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMY+ALLA G + A L KMPKDDPHV+YIIQ+C+ + +P + Sbjct: 794 LRMYQALLAGGDRKAARTLRGKMPKDDPHVRYIIQACKTAYSEPKS 839 >ref|XP_009358101.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Pyrus x bretschneideri] Length = 845 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATFIKPST 138 LRMY+ALLA G + A L KMPKDDPHV+YIIQ+C+ + +P + Sbjct: 794 LRMYQALLAGGDRKAARTLRGKMPKDDPHVRYIIQACKTAYSEPKS 839 >gb|OEL36115.1| Pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 883 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = +1 Query: 1 LRMYEALLASGAVRKASKLLKKMPKDDPHVQYIIQSCRATF----IKPSTT 141 LRMY+ALL+SG + A KLLK +PK+D HV+YII CR T+ KPS T Sbjct: 811 LRMYQALLSSGDRKAAKKLLKTIPKEDDHVRYIIDGCRMTYCSEGFKPSAT 861