BLASTX nr result
ID: Ophiopogon25_contig00021960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00021960 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256081.1| uncharacterized protein LOC109832971 isoform... 60 5e-08 ref|XP_020256079.1| uncharacterized protein LOC109832971 isoform... 60 5e-08 gb|ONK74322.1| uncharacterized protein A4U43_C03F5050 [Asparagus... 60 5e-08 >ref|XP_020256081.1| uncharacterized protein LOC109832971 isoform X2 [Asparagus officinalis] Length = 1229 Score = 60.5 bits (145), Expect = 5e-08 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = -1 Query: 206 VMKPEEAVSIKKDRDVSVASRDGRGYMIRKKNSIDGLSSEEEVKIDVKKVLKPKVGKERE 27 V+K E+A KK DVS AS++G+ M++KK+SI+ +SE+E ID +K K KV KERE Sbjct: 213 VVKWEDADEAKKVTDVSAASQNGKCSMVKKKSSINRSNSEQERNIDSEKRTKSKVVKERE 272 Query: 26 ELDSRKK 6 E S+KK Sbjct: 273 ETGSKKK 279 >ref|XP_020256079.1| uncharacterized protein LOC109832971 isoform X1 [Asparagus officinalis] ref|XP_020256080.1| uncharacterized protein LOC109832971 isoform X1 [Asparagus officinalis] Length = 1233 Score = 60.5 bits (145), Expect = 5e-08 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = -1 Query: 206 VMKPEEAVSIKKDRDVSVASRDGRGYMIRKKNSIDGLSSEEEVKIDVKKVLKPKVGKERE 27 V+K E+A KK DVS AS++G+ M++KK+SI+ +SE+E ID +K K KV KERE Sbjct: 213 VVKWEDADEAKKVTDVSAASQNGKCSMVKKKSSINRSNSEQERNIDSEKRTKSKVVKERE 272 Query: 26 ELDSRKK 6 E S+KK Sbjct: 273 ETGSKKK 279 >gb|ONK74322.1| uncharacterized protein A4U43_C03F5050 [Asparagus officinalis] Length = 1260 Score = 60.5 bits (145), Expect = 5e-08 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = -1 Query: 206 VMKPEEAVSIKKDRDVSVASRDGRGYMIRKKNSIDGLSSEEEVKIDVKKVLKPKVGKERE 27 V+K E+A KK DVS AS++G+ M++KK+SI+ +SE+E ID +K K KV KERE Sbjct: 213 VVKWEDADEAKKVTDVSAASQNGKCSMVKKKSSINRSNSEQERNIDSEKRTKSKVVKERE 272 Query: 26 ELDSRKK 6 E S+KK Sbjct: 273 ETGSKKK 279