BLASTX nr result
ID: Ophiopogon25_contig00021525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00021525 (790 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244585.1| abscisic acid 8'-hydroxylase 3-like isoform ... 73 2e-11 ref|XP_020244587.1| abscisic acid 8'-hydroxylase 3-like isoform ... 73 2e-11 gb|AEQ94120.1| putative cytochrome P450 protein, partial [Elaeis... 70 3e-11 gb|ATL77045.1| abscisic acid 8'-hydroxylase 1 [Phellodendron amu... 68 1e-10 ref|XP_016736796.1| PREDICTED: abscisic acid 8'-hydroxylase 1-li... 69 1e-10 ref|XP_016736795.1| PREDICTED: abscisic acid 8'-hydroxylase 1-li... 69 1e-10 ref|XP_012439193.1| PREDICTED: abscisic acid 8'-hydroxylase 1-li... 69 1e-10 dbj|BAH91860.1| Os02g0703600 [Oryza sativa Japonica Group] 72 2e-10 ref|XP_009414347.2| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 71 2e-10 ref|XP_020524371.1| abscisic acid 8'-hydroxylase 1 isoform X1 [A... 69 2e-10 gb|KDO72259.1| hypothetical protein CISIN_1g038621mg [Citrus sin... 67 2e-10 ref|NP_001275876.1| abscisic acid 8'-hydroxylase 1-like [Citrus ... 67 2e-10 ref|XP_006430894.1| abscisic acid 8'-hydroxylase 1 [Citrus cleme... 67 2e-10 ref|XP_006878626.1| abscisic acid 8'-hydroxylase 1 isoform X2 [A... 69 2e-10 gb|KVH91671.1| cytochrome P450 [Cynara cardunculus var. scolymus] 71 3e-10 ref|XP_017636427.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [G... 68 3e-10 ref|XP_016721170.1| PREDICTED: abscisic acid 8'-hydroxylase 1-li... 68 3e-10 gb|KHG19443.1| Abscisic acid 8'-hydroxylase 1 -like protein [Gos... 68 3e-10 gb|PKI57263.1| hypothetical protein CRG98_022360 [Punica granatum] 70 3e-10 gb|AHA85937.1| abscisic acid 8-hydroxylase 1, partial [Arachis h... 67 4e-10 >ref|XP_020244585.1| abscisic acid 8'-hydroxylase 3-like isoform X1 [Asparagus officinalis] ref|XP_020244586.1| abscisic acid 8'-hydroxylase 3-like isoform X1 [Asparagus officinalis] Length = 487 Score = 72.8 bits (177), Expect(2) = 2e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -1 Query: 502 VAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 VAPKPNT LPFGSGA SC GNELAKLEMLVL H TTKYR+ V Sbjct: 418 VAPKPNTFLPFGSGAHSCPGNELAKLEMLVLLHHLTTKYRWTV 460 Score = 24.6 bits (52), Expect(2) = 2e-11 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 378 KYQPLVLPKDGLPRTVPFST 319 ++ P LP+DGLP T T Sbjct: 468 QFSPFALPRDGLPITFTLKT 487 >ref|XP_020244587.1| abscisic acid 8'-hydroxylase 3-like isoform X2 [Asparagus officinalis] gb|ONK58871.1| uncharacterized protein A4U43_C08F590 [Asparagus officinalis] Length = 461 Score = 72.8 bits (177), Expect(2) = 2e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -1 Query: 502 VAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 VAPKPNT LPFGSGA SC GNELAKLEMLVL H TTKYR+ V Sbjct: 392 VAPKPNTFLPFGSGAHSCPGNELAKLEMLVLLHHLTTKYRWTV 434 Score = 24.6 bits (52), Expect(2) = 2e-11 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 378 KYQPLVLPKDGLPRTVPFST 319 ++ P LP+DGLP T T Sbjct: 442 QFSPFALPRDGLPITFTLKT 461 >gb|AEQ94120.1| putative cytochrome P450 protein, partial [Elaeis guineensis] Length = 164 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLEMLVL H TTKYR+ + S Sbjct: 94 EVAPKPNTFMPFGNGTHSCPGNELAKLEMLVLLHHLTTKYRWSMSGS 140 >gb|ATL77045.1| abscisic acid 8'-hydroxylase 1 [Phellodendron amurense] Length = 138 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 +VAPKPNT +PFG+G SC GNELAKLE+LVL H TTKYR+ + Sbjct: 68 EVAPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTI 111 >ref|XP_016736796.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like isoform X2 [Gossypium hirsutum] Length = 533 Score = 68.9 bits (167), Expect(2) = 1e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFGSG SC GNELAKLE++VL H TTKYR+ + S Sbjct: 464 EVAPKPNTFMPFGSGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 510 Score = 25.8 bits (55), Expect(2) = 1e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 511 NSGIQYGPFALPQNGLP 527 >ref|XP_016736795.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like isoform X1 [Gossypium hirsutum] Length = 533 Score = 68.9 bits (167), Expect(2) = 1e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFGSG SC GNELAKLE++VL H TTKYR+ + S Sbjct: 464 EVAPKPNTFMPFGSGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 510 Score = 25.8 bits (55), Expect(2) = 1e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 511 NSGIQYGPFALPQNGLP 527 >ref|XP_012439193.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Gossypium raimondii] gb|KJB51491.1| hypothetical protein B456_008G218900 [Gossypium raimondii] Length = 463 Score = 68.9 bits (167), Expect(2) = 1e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFGSG SC GNELAKLE++VL H TTKYR+ + S Sbjct: 394 EVAPKPNTFMPFGSGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 440 Score = 25.8 bits (55), Expect(2) = 1e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 441 NSGIQYGPFALPQNGLP 457 >dbj|BAH91860.1| Os02g0703600 [Oryza sativa Japonica Group] Length = 441 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = -1 Query: 511 LLQVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 LLQVAPKPNT +PFG+G SC GNELAKLEMLVL H TKYR+ S Sbjct: 365 LLQVAPKPNTFMPFGNGTHSCPGNELAKLEMLVLFHHLATKYRWSTSKS 413 >ref|XP_009414347.2| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Musa acuminata subsp. malaccensis] Length = 468 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT LPFGSGA +C GNELAKLEML+L H TKYR+++ S Sbjct: 397 EVAPKPNTFLPFGSGAHACPGNELAKLEMLILIHHLVTKYRWEIVGS 443 >ref|XP_020524371.1| abscisic acid 8'-hydroxylase 1 isoform X1 [Amborella trichopoda] Length = 479 Score = 68.6 bits (166), Expect(2) = 2e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLE+L+L H TTKYR+ V S Sbjct: 409 EVAPKPNTFMPFGNGIHSCPGNELAKLEILILLHHLTTKYRWTVMGS 455 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N G +Y P LP++GLP Sbjct: 456 NNGIQYSPFPLPQNGLP 472 >gb|KDO72259.1| hypothetical protein CISIN_1g038621mg [Citrus sinensis] Length = 477 Score = 67.4 bits (163), Expect(2) = 2e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 +V+PKPNT +PFG+G SC GNELAKLE+LVL H TTKYR+ V Sbjct: 396 EVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTV 439 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 NTG +Y P LP +GLP Sbjct: 443 NTGIQYGPFALPMNGLP 459 >ref|NP_001275876.1| abscisic acid 8'-hydroxylase 1-like [Citrus sinensis] gb|AEX15511.1| ABA 8'-hydroxylase [Citrus sinensis] dbj|GAY46258.1| hypothetical protein CUMW_095610 [Citrus unshiu] Length = 477 Score = 67.4 bits (163), Expect(2) = 2e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 +V+PKPNT +PFG+G SC GNELAKLE+LVL H TTKYR+ V Sbjct: 396 EVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTV 439 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 NTG +Y P LP +GLP Sbjct: 443 NTGIQYGPFALPMNGLP 459 >ref|XP_006430894.1| abscisic acid 8'-hydroxylase 1 [Citrus clementina] gb|ESR44134.1| hypothetical protein CICLE_v10011655mg [Citrus clementina] Length = 470 Score = 67.4 bits (163), Expect(2) = 2e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 +V+PKPNT +PFG+G SC GNELAKLE+LVL H TTKYR+ V Sbjct: 396 EVSPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRWTV 439 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 NTG +Y P LP +GLP Sbjct: 443 NTGIQYGPFALPMNGLP 459 >ref|XP_006878626.1| abscisic acid 8'-hydroxylase 1 isoform X2 [Amborella trichopoda] gb|ERM94771.1| hypothetical protein AMTR_s00011p00261570 [Amborella trichopoda] Length = 461 Score = 68.6 bits (166), Expect(2) = 2e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLE+L+L H TTKYR+ V S Sbjct: 391 EVAPKPNTFMPFGNGIHSCPGNELAKLEILILLHHLTTKYRWTVMGS 437 Score = 25.4 bits (54), Expect(2) = 2e-10 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N G +Y P LP++GLP Sbjct: 438 NNGIQYSPFPLPQNGLP 454 >gb|KVH91671.1| cytochrome P450 [Cynara cardunculus var. scolymus] Length = 447 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 QVAPKPNT +PFGSG SC GNELAKLE+LVL H TTKYR+ V Sbjct: 378 QVAPKPNTFMPFGSGVHSCPGNELAKLEILVLIHHLTTKYRWSV 421 >ref|XP_017636427.1| PREDICTED: abscisic acid 8'-hydroxylase 1 [Gossypium arboreum] Length = 463 Score = 67.8 bits (164), Expect(2) = 3e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLE++VL H TTKYR+ + S Sbjct: 394 EVAPKPNTFMPFGNGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 440 Score = 25.8 bits (55), Expect(2) = 3e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 441 NSGIQYGPFALPQNGLP 457 >ref|XP_016721170.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Gossypium hirsutum] Length = 463 Score = 67.8 bits (164), Expect(2) = 3e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLE++VL H TTKYR+ + S Sbjct: 394 EVAPKPNTFMPFGNGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 440 Score = 25.8 bits (55), Expect(2) = 3e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 441 NSGIQYGPFALPQNGLP 457 >gb|KHG19443.1| Abscisic acid 8'-hydroxylase 1 -like protein [Gossypium arboreum] Length = 423 Score = 67.8 bits (164), Expect(2) = 3e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT +PFG+G SC GNELAKLE++VL H TTKYR+ + S Sbjct: 354 EVAPKPNTFMPFGNGTHSCPGNELAKLEIMVLLHHLTTKYRWSMVGS 400 Score = 25.8 bits (55), Expect(2) = 3e-10 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 390 NTGTKYQPLVLPKDGLP 340 N+G +Y P LP++GLP Sbjct: 401 NSGIQYGPFALPQNGLP 417 >gb|PKI57263.1| hypothetical protein CRG98_022360 [Punica granatum] Length = 394 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQVPAS 365 +VAPKPNT LPFGSGA SC G+ELAKLE+LVL H TTKYR+ + +S Sbjct: 321 EVAPKPNTFLPFGSGAHSCPGSELAKLEILVLLHHLTTKYRWSMMSS 367 >gb|AHA85937.1| abscisic acid 8-hydroxylase 1, partial [Arachis hypogaea] Length = 160 Score = 67.4 bits (163), Expect = 4e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 505 QVAPKPNTILPFGSGAQSCQGNELAKLEMLVLQPHRTTKYRYQV 374 +VAPKPN+ +PFG+G +C GNELAKLEMLVL H TTKYR+ V Sbjct: 96 EVAPKPNSFMPFGNGVHACPGNELAKLEMLVLLHHLTTKYRWTV 139