BLASTX nr result
ID: Ophiopogon25_contig00020983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00020983 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250133.1| 26S proteasome non-ATPase regulatory subunit... 57 2e-06 ref|XP_008802342.2| PREDICTED: 26S proteasome non-ATPase regulat... 54 5e-06 ref|XP_010914322.1| PREDICTED: 26S proteasome non-ATPase regulat... 54 5e-06 ref|XP_009409664.1| PREDICTED: 26S proteasome non-ATPase regulat... 54 5e-06 ref|XP_009383633.1| PREDICTED: 26S proteasome non-ATPase regulat... 54 7e-06 >ref|XP_020250133.1| 26S proteasome non-ATPase regulatory subunit 8 homolog A [Asparagus officinalis] gb|ONK55302.1| uncharacterized protein A4U43_UnF5260 [Asparagus officinalis] Length = 267 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 131 VSDEIAGCSEKAYDYLSISNAKKILMYSSLTKNFRNISQRY 9 V DEIAGCSEKAYDYLSISNAKKILM+SS + R I + + Sbjct: 183 VRDEIAGCSEKAYDYLSISNAKKILMFSSDEELSRYIMEEH 223 >ref|XP_008802342.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Phoenix dactylifera] Length = 267 Score = 53.5 bits (127), Expect(2) = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 131 VSDEIAGCSEKAYDYLSISNAKKILMYSS 45 V DEIAGCSEKAYDYLSI++AKKILM+SS Sbjct: 183 VRDEIAGCSEKAYDYLSINDAKKILMFSS 211 Score = 24.3 bits (51), Expect(2) = 5e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 45 SDQELSQYITE 13 SDQELS+YITE Sbjct: 211 SDQELSEYITE 221 >ref|XP_010914322.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Elaeis guineensis] Length = 267 Score = 53.5 bits (127), Expect(2) = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 131 VSDEIAGCSEKAYDYLSISNAKKILMYSS 45 V DEIAGCSEKAYDYLSI++AKKILM+SS Sbjct: 183 VRDEIAGCSEKAYDYLSINDAKKILMFSS 211 Score = 24.3 bits (51), Expect(2) = 5e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 45 SDQELSQYITE 13 SDQELS+YITE Sbjct: 211 SDQELSEYITE 221 >ref|XP_009409664.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Musa acuminata subsp. malaccensis] Length = 267 Score = 53.5 bits (127), Expect(2) = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 131 VSDEIAGCSEKAYDYLSISNAKKILMYSS 45 V DEIAGCSEKAYDYLSI++AKKILM+SS Sbjct: 183 VRDEIAGCSEKAYDYLSINDAKKILMFSS 211 Score = 24.3 bits (51), Expect(2) = 5e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 45 SDQELSQYITE 13 SDQELS+YITE Sbjct: 211 SDQELSEYITE 221 >ref|XP_009383633.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 8 homolog A [Musa acuminata subsp. malaccensis] Length = 267 Score = 54.3 bits (129), Expect(2) = 7e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 131 VSDEIAGCSEKAYDYLSISNAKKILMYSS 45 V DEIAGCSEKAYDYLSI+NAKKILM+S+ Sbjct: 183 VRDEIAGCSEKAYDYLSINNAKKILMFST 211 Score = 23.1 bits (48), Expect(2) = 7e-06 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -2 Query: 45 SDQELSQYITE 13 +DQELS+YITE Sbjct: 211 TDQELSEYITE 221