BLASTX nr result
ID: Ophiopogon25_contig00020761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00020761 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020702151.1| pentatricopeptide repeat-containing protein ... 78 9e-14 ref|XP_008797547.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-12 ref|XP_010275265.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-11 ref|XP_010693152.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-11 ref|XP_021859975.1| pentatricopeptide repeat-containing protein ... 71 2e-11 ref|XP_020589284.1| pentatricopeptide repeat-containing protein ... 70 4e-11 ref|XP_020589283.1| pentatricopeptide repeat-containing protein ... 70 4e-11 gb|PKA61213.1| Pentatricopeptide repeat-containing protein [Apos... 69 1e-10 gb|OVA01761.1| Pentatricopeptide repeat [Macleaya cordata] 68 3e-10 ref|XP_021757347.1| pentatricopeptide repeat-containing protein ... 68 3e-10 gb|EEF28217.1| pentatricopeptide repeat-containing protein, puta... 68 4e-10 ref|XP_002534168.2| PREDICTED: pentatricopeptide repeat-containi... 68 4e-10 emb|CDO98371.1| unnamed protein product [Coffea canephora] 67 5e-10 ref|XP_021722791.1| pentatricopeptide repeat-containing protein ... 67 7e-10 gb|PON37643.1| DYW domain containing protein [Parasponia anderso... 67 7e-10 gb|KVI11791.1| hypothetical protein Ccrd_009794 [Cynara carduncu... 67 7e-10 ref|XP_017247408.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_010927442.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 gb|POE92171.1| pentatricopeptide repeat-containing protein [Quer... 66 2e-09 ref|XP_023927181.1| pentatricopeptide repeat-containing protein ... 66 2e-09 >ref|XP_020702151.1| pentatricopeptide repeat-containing protein At4g02750 [Dendrobium catenatum] Length = 769 Score = 78.2 bits (191), Expect = 9e-14 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 A+VVRWN I+ +MR G+FD ARQ+FD+MPRRT V+WN MLSGY+SN+++S Sbjct: 50 ADVVRWNKTITYHMRHGRFDAARQLFDQMPRRTIVSWNTMLSGYLSNDQYS 100 >ref|XP_008797547.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Phoenix dactylifera] Length = 778 Score = 72.8 bits (177), Expect = 7e-12 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 AE++RWN AI+++MR G+ D A +FD MPRR+TV+WN M+SGYI+N RF Sbjct: 59 AEILRWNKAITDHMRHGRCDAAADLFDRMPRRSTVSWNTMISGYIANGRF 108 >ref|XP_010275265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nelumbo nucifera] ref|XP_010275266.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Nelumbo nucifera] Length = 772 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 AEVV+WN+ IS +MR GQ D A +F MPRRT+V+WNAM+SGY+ N+RF Sbjct: 53 AEVVKWNMTISEHMRNGQCDSALHLFQTMPRRTSVSWNAMISGYLMNDRF 102 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 V WN IS + +FD+AR FD+MP R V+WN MLSG++ N S Sbjct: 87 VSWNAMISGYLMNDRFDLARHFFDKMPSRDLVSWNVMLSGFVKNRNLS 134 >ref|XP_010693152.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Beta vulgaris subsp. vulgaris] gb|KMS99291.1| hypothetical protein BVRB_2g046200 [Beta vulgaris subsp. vulgaris] Length = 774 Score = 71.2 bits (173), Expect = 2e-11 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +V++WN ISN MRRGQ+ +A ++F MPRRT V+WNAM++GY+SN RF Sbjct: 56 DVIKWNTQISNYMRRGQYRLAVELFHSMPRRTVVSWNAMITGYLSNGRF 104 >ref|XP_021859975.1| pentatricopeptide repeat-containing protein At4g02750 [Spinacia oleracea] Length = 778 Score = 71.2 bits (173), Expect = 2e-11 Identities = 27/49 (55%), Positives = 42/49 (85%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 ++++WN I+N+MRRG F++A ++F MP+RT V+WNAM+SGY+SN+RF Sbjct: 60 DIIKWNTRITNHMRRGHFELALELFSIMPQRTVVSWNAMISGYLSNHRF 108 >ref|XP_020589284.1| pentatricopeptide repeat-containing protein At4g02750 isoform X2 [Phalaenopsis equestris] Length = 744 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 ++VRWN I+ +MR G+ D ARQ+FD+MPRRT V+WN MLSGY+ N ++S Sbjct: 50 DIVRWNKNITYHMRHGRCDAARQLFDQMPRRTIVSWNTMLSGYLCNGKYS 99 >ref|XP_020589283.1| pentatricopeptide repeat-containing protein At4g02750 isoform X1 [Phalaenopsis equestris] Length = 768 Score = 70.5 bits (171), Expect = 4e-11 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 ++VRWN I+ +MR G+ D ARQ+FD+MPRRT V+WN MLSGY+ N ++S Sbjct: 50 DIVRWNKNITYHMRHGRCDAARQLFDQMPRRTIVSWNTMLSGYLCNGKYS 99 >gb|PKA61213.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 739 Score = 68.9 bits (167), Expect = 1e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 +V+RWN I+N MR G+ D A Q+F+EMPRR+ V+WN MLSGY+SN R++ Sbjct: 21 DVLRWNKVITNYMRNGRCDDASQLFEEMPRRSIVSWNVMLSGYLSNGRYA 70 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNR 8 ++V WN I+ + R G AR+MFDEMP R TV+WN M+S Y N R Sbjct: 83 DLVSWNTMINGHFRFGNLQAARRMFDEMPLRDTVSWNTMISAYSQNGR 130 >gb|OVA01761.1| Pentatricopeptide repeat [Macleaya cordata] Length = 776 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/49 (59%), Positives = 43/49 (87%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 EVV+ N+AIS++MR GQ + A ++FD MPRRT+V+WNAM+SGY++N++F Sbjct: 58 EVVKLNMAISDHMRNGQLESALRIFDGMPRRTSVSWNAMISGYLNNDKF 106 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 V WN IS + +FD+AR +FD+MP+R V+WN MLSGY+ N + S Sbjct: 91 VSWNAMISGYLNNDKFDLARSLFDKMPKRDLVSWNVMLSGYVRNRKLS 138 >ref|XP_021757347.1| pentatricopeptide repeat-containing protein At4g02750-like [Chenopodium quinoa] Length = 778 Score = 68.2 bits (165), Expect = 3e-10 Identities = 26/49 (53%), Positives = 39/49 (79%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 ++++WN I+N MRRG F+ A ++F+ MP RT V+WN+M+SGY+SN RF Sbjct: 60 DIIKWNTQITNYMRRGHFESALELFNSMPSRTVVSWNSMISGYLSNRRF 108 >gb|EEF28217.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 513 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +++V WN+AI+ +MR GQ A Q+F+ MPRR+TVT+NAM+SGY+SN RF Sbjct: 55 SDIVNWNMAITTHMRNGQCHSALQVFNTMPRRSTVTYNAMISGYLSNGRF 104 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 V +N IS + G+FD+AR+MFD+MP R TWN MLSGY+ N + Sbjct: 89 VTYNAMISGYLSNGRFDLAREMFDKMPERDLFTWNVMLSGYVRNKNLT 136 >ref|XP_002534168.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Ricinus communis] ref|XP_015583860.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Ricinus communis] Length = 774 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +++V WN+AI+ +MR GQ A Q+F+ MPRR+TVT+NAM+SGY+SN RF Sbjct: 55 SDIVNWNMAITTHMRNGQCHSALQVFNTMPRRSTVTYNAMISGYLSNGRF 104 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRFS 2 V +N IS + G+FD+AR+MFD+MP R TWN MLSGY+ N + Sbjct: 89 VTYNAMISGYLSNGRFDLAREMFDKMPERDLFTWNVMLSGYVRNKNLT 136 >emb|CDO98371.1| unnamed protein product [Coffea canephora] Length = 777 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/50 (56%), Positives = 41/50 (82%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +++V+ NIAI+ MR GQFD A Q+F+ M R+T+VTWN M+SGY+SN++F Sbjct: 58 SDIVKCNIAITKYMRNGQFDAALQLFNSMARKTSVTWNTMISGYLSNDQF 107 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISN 14 V WN IS + QF++A+++FD+MP+R V+WN M+SGYI N Sbjct: 92 VTWNTMISGYLSNDQFELAKKVFDKMPQRDLVSWNVMISGYIKN 135 >ref|XP_021722791.1| pentatricopeptide repeat-containing protein At4g02750-like [Chenopodium quinoa] Length = 778 Score = 67.0 bits (162), Expect = 7e-10 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 ++++WN I+N MRRG F+ A ++F MP RT VTWN+M+SGY+ N RF Sbjct: 60 DIIKWNTQITNYMRRGHFESALELFHSMPSRTVVTWNSMISGYLCNRRF 108 >gb|PON37643.1| DYW domain containing protein [Parasponia andersonii] Length = 779 Score = 67.0 bits (162), Expect = 7e-10 Identities = 27/50 (54%), Positives = 44/50 (88%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 A+VV+WN+AI++ MR GQ++ A ++F++MPRR+ V++NAM+SGY+SN +F Sbjct: 60 ADVVKWNMAITSYMRNGQWEAALRVFNDMPRRSVVSFNAMISGYLSNEKF 109 >gb|KVI11791.1| hypothetical protein Ccrd_009794 [Cynara cardunculus var. scolymus] Length = 782 Score = 67.0 bits (162), Expect = 7e-10 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = -2 Query: 148 VVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +V+WN I+N MR GQ D A +MF++M +RT+V+WNAM+SGY+ NNRF Sbjct: 65 IVQWNTTITNYMRSGQCDSALRMFEKMSQRTSVSWNAMISGYLMNNRF 112 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISN 14 ++V WN+ I+ +R G +AR++FD+MP R V+WNAMLSGY N Sbjct: 126 DLVSWNVMITGCVRNGNLGMARKLFDQMPERDAVSWNAMLSGYAQN 171 >ref|XP_017247408.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Daucus carota subsp. sativus] Length = 772 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 +++V+ N+AI+N MR GQ D A+ +FD + RR++VTWNAM+SGY+SNNRF Sbjct: 53 SDIVKNNMAITNYMRIGQCDSAQGLFDSLSRRSSVTWNAMISGYLSNNRF 102 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = -2 Query: 145 VRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISN 14 V WN IS + +F++A +MFD+MP R VTWN MLSGY+ N Sbjct: 87 VTWNAMISGYLSNNRFELAHKMFDKMPERDLVTWNVMLSGYVKN 130 >ref|XP_010927442.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Elaeis guineensis] Length = 777 Score = 66.6 bits (161), Expect = 1e-09 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = -2 Query: 154 AEVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 AE++RWN I+++MR G+ D A +F MP R+TV+WNAM+SGYI+N+RF Sbjct: 58 AEILRWNKIITDHMRHGRCDFAADLFYRMPSRSTVSWNAMISGYIANSRF 107 >gb|POE92171.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 478 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/49 (53%), Positives = 43/49 (87%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 E+V+WN++I+ +MR GQ+ A Q+F+ MPRR++V++NAM+SGY+SN++F Sbjct: 59 EIVKWNMSITTHMRNGQWKSALQVFNSMPRRSSVSYNAMISGYLSNDKF 107 >ref|XP_023927181.1| pentatricopeptide repeat-containing protein At4g02750 isoform X2 [Quercus suber] Length = 776 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/49 (53%), Positives = 43/49 (87%) Frame = -2 Query: 151 EVVRWNIAISNNMRRGQFDVARQMFDEMPRRTTVTWNAMLSGYISNNRF 5 E+V+WN++I+ +MR GQ+ A Q+F+ MPRR++V++NAM+SGY+SN++F Sbjct: 59 EIVKWNMSITTHMRNGQWKSALQVFNSMPRRSSVSYNAMISGYLSNDKF 107