BLASTX nr result
ID: Ophiopogon25_contig00019472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00019472 (870 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU86035.1| hypothetical protein MA16_Dca001866 [Dendrobium c... 56 1e-06 >gb|PKU86035.1| hypothetical protein MA16_Dca001866 [Dendrobium catenatum] Length = 85 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +1 Query: 568 YMEKRQVFLRSYHFSRKKTGMEKARCSAVRVRKLICV 678 YMEKR++FLRSYH SRK++ ++ R SAVRVR+L+CV Sbjct: 17 YMEKRRLFLRSYHLSRKRSAADRLRISAVRVRRLVCV 53