BLASTX nr result
ID: Ophiopogon25_contig00019130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00019130 (725 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274673.1| 14-3-3 protein 7-like isoform X2 [Asparagus ... 59 9e-07 ref|XP_020274672.1| 14-3-3 protein 7-like isoform X1 [Asparagus ... 59 1e-06 gb|KVI05536.1| 14-3-3 domain-containing protein [Cynara carduncu... 58 2e-06 ref|XP_010258087.1| PREDICTED: 14-3-3-like protein GF14 iota [Ne... 58 2e-06 ref|XP_021997296.1| 14-3-3-like protein GF14 iota [Helianthus an... 58 2e-06 ref|XP_021976356.1| 14-3-3-like protein GF14 iota [Helianthus an... 58 2e-06 gb|OTG04504.1| putative 14-3-3 domain-containing protein [Helian... 58 3e-06 gb|OVA18895.1| 14-3-3 protein [Macleaya cordata] 58 3e-06 gb|API85522.1| FT-6, partial [Haloxylon ammodendron] 57 3e-06 ref|XP_008807824.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 58 3e-06 ref|XP_008807823.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 58 3e-06 ref|XP_021645782.1| 14-3-3-like protein GF14 iota [Hevea brasili... 58 3e-06 gb|PIA57663.1| hypothetical protein AQUCO_00600416v1 [Aquilegia ... 57 4e-06 ref|XP_016443542.1| PREDICTED: 14-3-3-like protein GF14 iota [Ni... 57 4e-06 ref|XP_010259579.1| PREDICTED: 14-3-3-like protein GF14 iota [Ne... 57 5e-06 ref|XP_015894964.1| PREDICTED: 14-3-3-like protein GF14 iota [Zi... 57 6e-06 gb|OIV93215.1| hypothetical protein TanjilG_27394 [Lupinus angus... 55 6e-06 gb|KOM31739.1| hypothetical protein LR48_Vigan01g129400 [Vigna a... 57 7e-06 gb|KYP76550.1| 14-3-3-like protein GF14 iota [Cajanus cajan] 57 7e-06 ref|XP_021756924.1| 14-3-3-like protein GF14 iota [Chenopodium q... 57 7e-06 >ref|XP_020274673.1| 14-3-3 protein 7-like isoform X2 [Asparagus officinalis] Length = 236 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFKND+ERK+AAEQSL+GYQ Sbjct: 101 KMKGDYYRYLAEFKNDEERKEAAEQSLKGYQ 131 >ref|XP_020274672.1| 14-3-3 protein 7-like isoform X1 [Asparagus officinalis] gb|ONK64718.1| uncharacterized protein A4U43_C07F29150 [Asparagus officinalis] Length = 261 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFKND+ERK+AAEQSL+GYQ Sbjct: 126 KMKGDYYRYLAEFKNDEERKEAAEQSLKGYQ 156 >gb|KVI05536.1| 14-3-3 domain-containing protein [Cynara cardunculus var. scolymus] Length = 253 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDAAEQSLKGYE 156 >ref|XP_010258087.1| PREDICTED: 14-3-3-like protein GF14 iota [Nelumbo nucifera] Length = 259 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDAAEQSLKGYE 156 >ref|XP_021997296.1| 14-3-3-like protein GF14 iota [Helianthus annuus] ref|XP_021997297.1| 14-3-3-like protein GF14 iota [Helianthus annuus] Length = 262 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDAAEQSLKGYE 156 >ref|XP_021976356.1| 14-3-3-like protein GF14 iota [Helianthus annuus] gb|OTG17405.1| putative general regulatory factor 12 [Helianthus annuus] Length = 262 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDAAEQSLKGYE 156 >gb|OTG04504.1| putative 14-3-3 domain-containing protein [Helianthus annuus] Length = 287 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAAEQSL+GY+ Sbjct: 151 KMKGDYYRYLAEFKTDQERKDAAEQSLKGYE 181 >gb|OVA18895.1| 14-3-3 protein [Macleaya cordata] Length = 294 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAA+QSL+GYQ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDAADQSLKGYQ 156 >gb|API85522.1| FT-6, partial [Haloxylon ammodendron] Length = 196 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDY+RYLAEFK+DQERKDAAEQSL+GY+ Sbjct: 61 KMKGDYFRYLAEFKSDQERKDAAEQSLKGYE 91 >ref|XP_008807824.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Phoenix dactylifera] Length = 260 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GYQ Sbjct: 126 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYQ 156 >ref|XP_008807823.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Phoenix dactylifera] Length = 260 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GYQ Sbjct: 126 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYQ 156 >ref|XP_021645782.1| 14-3-3-like protein GF14 iota [Hevea brasiliensis] Length = 261 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFKNDQERK+AA+QSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKNDQERKEAADQSLKGYE 156 >gb|PIA57663.1| hypothetical protein AQUCO_00600416v1 [Aquilegia coerulea] Length = 270 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDAA+QSLE YQ Sbjct: 124 KMKGDYYRYLAEFKTDQERKDAADQSLESYQ 154 >ref|XP_016443542.1| PREDICTED: 14-3-3-like protein GF14 iota [Nicotiana tabacum] Length = 206 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GY+ Sbjct: 101 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYE 131 >ref|XP_010259579.1| PREDICTED: 14-3-3-like protein GF14 iota [Nelumbo nucifera] Length = 259 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERKDA++QSL+GYQ Sbjct: 126 KMKGDYYRYLAEFKTDQERKDASDQSLKGYQ 156 >ref|XP_015894964.1| PREDICTED: 14-3-3-like protein GF14 iota [Ziziphus jujuba] Length = 234 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GY+ Sbjct: 101 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYE 131 >gb|OIV93215.1| hypothetical protein TanjilG_27394 [Lupinus angustifolius] Length = 149 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDY+RYLAEFK DQERK+AAEQSL+GY+ Sbjct: 101 KMKGDYFRYLAEFKTDQERKEAAEQSLKGYE 131 >gb|KOM31739.1| hypothetical protein LR48_Vigan01g129400 [Vigna angularis] Length = 248 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYE 156 >gb|KYP76550.1| 14-3-3-like protein GF14 iota [Cajanus cajan] Length = 249 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDYYRYLAEFK DQERK+AAEQSL+GY+ Sbjct: 126 KMKGDYYRYLAEFKTDQERKEAAEQSLKGYE 156 >ref|XP_021756924.1| 14-3-3-like protein GF14 iota [Chenopodium quinoa] Length = 258 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 476 KRTGDYYRYLAEFKNDQERKDAAEQSLEGYQ 384 K GDY+RYLAEFK+DQERKDAAEQSL GY+ Sbjct: 126 KMKGDYFRYLAEFKSDQERKDAAEQSLNGYE 156