BLASTX nr result
ID: Ophiopogon25_contig00019117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00019117 (706 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU79361.1| integrator complex subunit 11 [Dendrobium catenatum] 62 2e-08 gb|PKA62335.1| ataxia telangiectasia mutated family protein [Apo... 57 2e-08 gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] 54 5e-08 gb|PKU64612.1| integrator complex subunit 11 [Dendrobium catenatum] 60 6e-08 gb|PKU63885.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU81438.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU73925.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU85733.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU64467.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU76654.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU75588.1| ataxia telangiectasia mutated family protein [Den... 60 6e-08 gb|PKU83370.1| ataxia telangiectasia mutated family protein [Den... 60 7e-08 gb|PKU81681.1| ataxia telangiectasia mutated family protein [Den... 60 7e-08 gb|PKU69530.1| ataxia telangiectasia mutated family protein [Den... 60 7e-08 gb|PKU81295.1| ataxia telangiectasia mutated family protein [Den... 60 7e-08 gb|PKU76454.1| ataxia telangiectasia mutated family protein [Den... 60 7e-08 gb|PKU73550.1| ataxia telangiectasia mutated family protein [Den... 60 8e-08 gb|PKU74657.1| integrator complex subunit 11 [Dendrobium catenatum] 60 1e-07 gb|PKU74878.1| ataxia telangiectasia mutated family protein [Den... 60 1e-07 gb|PKU81488.1| ataxia telangiectasia mutated family protein [Den... 60 1e-07 >gb|PKU79361.1| integrator complex subunit 11 [Dendrobium catenatum] Length = 477 Score = 62.0 bits (149), Expect(2) = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRD+IRNE IH+K+ VA +EDKI ES Sbjct: 365 VTEMRMLRWMSGFTLRDKIRNEHIHEKVGVAPVEDKIRES 404 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 404 SRLRWFGHIKRRPFDDP 420 >gb|PKA62335.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 123 Score = 56.6 bits (135), Expect(2) = 2e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWM G T +DRIRNE I KK+ VA IEDK+ ES Sbjct: 20 VAEMRMLRWMCGYTRKDRIRNEYIRKKVGVAPIEDKLRES 59 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WFRH+ RRP+ AP Sbjct: 59 SRLRWFRHLNRRPIEAP 75 >gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 54.3 bits (129), Expect(2) = 5e-08 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEE 51 V EMRMLRWMSG T DRI+NE I K+ VA IEDK+ E Sbjct: 986 VAEMRMLRWMSGQTRMDRIKNEVIRSKVGVAPIEDKVRE 1024 Score = 31.2 bits (69), Expect(2) = 5e-08 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -1 Query: 49 RLGWFRHVQRRPLYAP 2 RL WF HVQRRPL AP Sbjct: 1026 RLRWFGHVQRRPLEAP 1041 >gb|PKU64612.1| integrator complex subunit 11 [Dendrobium catenatum] Length = 477 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 365 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 404 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 404 SRLRWFGHIKRRPFDDP 420 >gb|PKU63885.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 377 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 265 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 304 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 304 SRLRWFGHIKRRPFDDP 320 >gb|PKU81438.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 349 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 237 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 276 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 276 SRLRWFGHIKRRPFDDP 292 >gb|PKU73925.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 349 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 237 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 276 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 276 SRLRWFGHIKRRPFDDP 292 >gb|PKU85733.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 146 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 185 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 185 SRLRWFGHIKRRPFDDP 201 >gb|PKU64467.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 221 Score = 60.1 bits (144), Expect(2) = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 109 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 148 Score = 25.4 bits (54), Expect(2) = 6e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 148 SRLRWFGHIKRRPFDDP 164 >gb|PKU76654.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 132 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 20 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 59 >gb|PKU75588.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] gb|PKU79920.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 132 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 20 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 59 >gb|PKU83370.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 138 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 26 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 65 >gb|PKU81681.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 138 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 26 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 65 >gb|PKU69530.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 138 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 26 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 65 >gb|PKU81295.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 377 Score = 60.1 bits (144), Expect(2) = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 265 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 304 Score = 25.0 bits (53), Expect(2) = 7e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 304 SRLRWFGHIKRRPCDDP 320 >gb|PKU76454.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 377 Score = 60.1 bits (144), Expect(2) = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 265 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 304 Score = 25.0 bits (53), Expect(2) = 7e-08 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 52 NRLGWFRHVQRRPLYAP 2 +RL WF H++RRP P Sbjct: 304 SRLRWFGHIKRRPCDDP 320 >gb|PKU73550.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 60.5 bits (145), Expect(2) = 8e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA IEDKI ES Sbjct: 146 VTEMRMLRWMSGFTLRDRIRNEHIREKVGVAPIEDKIRES 185 Score = 24.6 bits (52), Expect(2) = 8e-08 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 52 NRLGWFRHVQRRP 14 +RL WF H++RRP Sbjct: 185 SRLRWFGHIKRRP 197 >gb|PKU74657.1| integrator complex subunit 11 [Dendrobium catenatum] Length = 447 Score = 60.1 bits (144), Expect(2) = 1e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 365 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 404 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 52 NRLGWFRHVQRRP 14 +RL WF H++RRP Sbjct: 404 SRLRWFGHIKRRP 416 >gb|PKU74878.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 361 Score = 60.1 bits (144), Expect(2) = 1e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 249 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 288 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 52 NRLGWFRHVQRRP 14 +RL WF H++RRP Sbjct: 288 SRLRWFGHIKRRP 300 >gb|PKU81488.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 60.1 bits (144), Expect(2) = 1e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 167 VVEMRMLRWMSGNTLRDRIRNECIHKKLEVALIEDKIEES 48 V EMRMLRWMSG TLRDRIRNE I +K+ VA +EDKI ES Sbjct: 146 VAEMRMLRWMSGFTLRDRIRNEHIREKVGVAPVEDKIRES 185 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 52 NRLGWFRHVQRRP 14 +RL WF H++RRP Sbjct: 185 SRLRWFGHIKRRP 197