BLASTX nr result
ID: Ophiopogon25_contig00019115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00019115 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262354.1| disease resistance protein RGA2-like [Aspara... 72 4e-12 gb|ONK71425.1| uncharacterized protein A4U43_C04F8440 [Asparagus... 72 1e-11 ref|XP_020271898.1| putative disease resistance protein RGA3 [As... 72 1e-11 ref|XP_020254649.1| putative disease resistance protein RGA3 iso... 70 4e-11 ref|XP_020254647.1| putative disease resistance protein RGA3 iso... 70 4e-11 ref|XP_020270610.1| putative disease resistance protein RGA3 [As... 70 5e-11 gb|ONK66283.1| uncharacterized protein A4U43_C06F6100 [Asparagus... 70 7e-11 ref|XP_020268733.1| disease resistance protein RGA2-like [Aspara... 70 7e-11 ref|XP_020254735.1| putative disease resistance protein RGA4 [As... 70 7e-11 ref|XP_020270617.1| putative disease resistance protein RGA3 [As... 69 2e-10 ref|XP_020268735.1| putative disease resistance protein RGA3 [As... 69 2e-10 ref|XP_020270613.1| uncharacterized protein LOC109845753 [Aspara... 64 3e-09 gb|ONK66333.1| uncharacterized protein A4U43_C06F6650 [Asparagus... 65 4e-09 ref|XP_020269337.1| putative disease resistance protein RGA3 iso... 65 4e-09 gb|ONK66281.1| uncharacterized protein A4U43_C06F6080 [Asparagus... 64 7e-09 gb|OAY72226.1| putative disease resistance RPP13-like protein 1 ... 63 1e-08 ref|XP_020082502.1| disease resistance protein RGA2-like isoform... 63 1e-08 ref|XP_020098652.1| disease resistance protein RGA2-like isoform... 63 1e-08 ref|XP_020082499.1| disease resistance protein RGA2-like isoform... 63 1e-08 ref|XP_020098649.1| disease resistance protein RGA2-like isoform... 63 1e-08 >ref|XP_020262354.1| disease resistance protein RGA2-like [Asparagus officinalis] Length = 242 Score = 71.6 bits (174), Expect = 4e-12 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L+L EA LQS+P+LP SL L I GCNETL +RC++ EGADWPNI HI +I ID Sbjct: 188 LTLGEACDLQSLPQLPLSLRTLMIGGCNETLKERCRENEGADWPNIRHIPDIDID 242 >gb|ONK71425.1| uncharacterized protein A4U43_C04F8440 [Asparagus officinalis] Length = 1151 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L+L EA LQS+P+LP SL L I GCNETL +RC++ EGADWPNI HI +I ID Sbjct: 1097 LTLGEACDLQSLPQLPLSLRTLMIGGCNETLKERCRENEGADWPNIRHIPDIDID 1151 >ref|XP_020271898.1| putative disease resistance protein RGA3 [Asparagus officinalis] Length = 1221 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L+L EA LQS+P+LP SL L I GCNETL +RC++ EGADWPNI HI +I ID Sbjct: 1167 LTLGEACDLQSLPQLPLSLRTLMIGGCNETLKERCRENEGADWPNIRHIPDIDID 1221 >ref|XP_020254649.1| putative disease resistance protein RGA3 isoform X3 [Asparagus officinalis] Length = 1227 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNI 159 L + A LQS+PR+PSSLE L I GCNETL++RC ++EGADWPNI HI I Sbjct: 1169 LKIHGAYQLQSLPRMPSSLEWLRIDGCNETLVERCAEDEGADWPNIKHIPEI 1220 >ref|XP_020254647.1| putative disease resistance protein RGA3 isoform X1 [Asparagus officinalis] ref|XP_020254648.1| putative disease resistance protein RGA3 isoform X2 [Asparagus officinalis] Length = 1241 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNI 159 L + A LQS+PR+PSSLE L I GCNETL++RC ++EGADWPNI HI I Sbjct: 1169 LKIHGAYQLQSLPRMPSSLEWLRIDGCNETLVERCAEDEGADWPNIKHIPEI 1220 >ref|XP_020270610.1| putative disease resistance protein RGA3 [Asparagus officinalis] Length = 1232 Score = 70.1 bits (170), Expect = 5e-11 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L L +A LQS+P+LPSSL+ L I GCNE L +RC++ EGADWPNI HI I ID Sbjct: 1178 LELRDACELQSLPQLPSSLQWLEIRGCNEALKERCRENEGADWPNIQHIPKIDID 1232 >gb|ONK66283.1| uncharacterized protein A4U43_C06F6100 [Asparagus officinalis] Length = 704 Score = 69.7 bits (169), Expect = 7e-11 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWI 165 LSL EA LQS+P+LP SL+ L I+GC+E L +RC++ EGADWPNI HI +I I Sbjct: 650 LSLGEAYELQSLPQLPLSLQFLMILGCSEALKERCRENEGADWPNIRHIPHITI 703 >ref|XP_020268733.1| disease resistance protein RGA2-like [Asparagus officinalis] Length = 1223 Score = 69.7 bits (169), Expect = 7e-11 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWI 165 LSL EA LQS+P+LP SL+ L I+GC+E L +RC++ EGADWPNI HI +I I Sbjct: 1169 LSLGEAYELQSLPQLPLSLQFLMILGCSEALKERCRENEGADWPNIRHIPHITI 1222 >ref|XP_020254735.1| putative disease resistance protein RGA4 [Asparagus officinalis] ref|XP_020254736.1| putative disease resistance protein RGA4 [Asparagus officinalis] ref|XP_020254738.1| putative disease resistance protein RGA4 [Asparagus officinalis] ref|XP_020254739.1| putative disease resistance protein RGA4 [Asparagus officinalis] ref|XP_020254740.1| putative disease resistance protein RGA4 [Asparagus officinalis] gb|ONK78568.1| uncharacterized protein A4U43_C02F20190 [Asparagus officinalis] Length = 1234 Score = 69.7 bits (169), Expect = 7e-11 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNI 159 L + A LQS+PR+PSSL L+I+GCN TL++RC ++EGADWPNI HI I Sbjct: 1169 LKITGAHQLQSLPRMPSSLRWLSILGCNGTLVERCAEDEGADWPNIKHIPRI 1220 >ref|XP_020270617.1| putative disease resistance protein RGA3 [Asparagus officinalis] Length = 964 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNI 159 L+L EAR LQS+P+LP SL L I CNE L +RC++ EGADWPNI HI +I Sbjct: 875 LTLREARELQSLPQLPLSLRSLEIQSCNEALKERCRENEGADWPNIQHIPHI 926 >ref|XP_020268735.1| putative disease resistance protein RGA3 [Asparagus officinalis] ref|XP_020268736.1| putative disease resistance protein RGA3 [Asparagus officinalis] Length = 1172 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWI 165 L+L EA LQS+P+LP SL L I GCNE L +RC++ EGADWPNI HI I I Sbjct: 1118 LTLGEAYELQSLPQLPLSLRTLEIRGCNEALKERCRENEGADWPNIRHITYIHI 1171 >ref|XP_020270613.1| uncharacterized protein LOC109845753 [Asparagus officinalis] Length = 241 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNI 141 L+L EA LQS+P+LP SL L I GCNETL +RC++ EGADWPNI Sbjct: 188 LTLGEACDLQSLPQLPLSLRTLMIGGCNETLKERCRENEGADWPNI 233 >gb|ONK66333.1| uncharacterized protein A4U43_C06F6650 [Asparagus officinalis] Length = 944 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L L LQS+P+LP SL L I GCNE L +RC++ EGADWPNI HI I ID Sbjct: 890 LELVGVYELQSLPQLPLSLRTLMIRGCNEALKERCRENEGADWPNIQHIPVIIID 944 >ref|XP_020269337.1| putative disease resistance protein RGA3 isoform X2 [Asparagus officinalis] Length = 1212 Score = 64.7 bits (156), Expect = 4e-09 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L L LQS+P+LP SL L I GCNE L +RC++ EGADWPNI HI I ID Sbjct: 1158 LELVGVYELQSLPQLPLSLRTLMIRGCNEALKERCRENEGADWPNIQHIPVIIID 1212 >gb|ONK66281.1| uncharacterized protein A4U43_C06F6080 [Asparagus officinalis] Length = 1164 Score = 63.9 bits (154), Expect = 7e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNI 141 L+L EA LQS+P+LP SL L I GCNETL +RC++ EGADWPNI Sbjct: 1111 LTLGEACDLQSLPQLPLSLRTLMIGGCNETLKERCRENEGADWPNI 1156 >gb|OAY72226.1| putative disease resistance RPP13-like protein 1 [Ananas comosus] Length = 1040 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L + +ARL+QS+P LP+SL L I GC+ L +RCQ+ G DWP I +I +WI+ Sbjct: 986 LEVHDARLIQSLPDLPTSLHTLYITGCHPALKERCQENVGLDWPKIANISELWIE 1040 >ref|XP_020082502.1| disease resistance protein RGA2-like isoform X2 [Ananas comosus] Length = 1220 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L + +A L+QS+P LP+SL L I+ C+ L +RCQ+ G DWP I HI N+WI+ Sbjct: 1153 LKVNDANLIQSLPNLPTSLRYLWILECHPVLKERCQENVGLDWPKIAHIPNVWIE 1207 >ref|XP_020098652.1| disease resistance protein RGA2-like isoform X2 [Ananas comosus] Length = 1221 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L + +A L+QS+P LP+SL L I+ C+ L +RCQ+ G DWP I HI N+WI+ Sbjct: 1154 LKVNDANLIQSLPNLPTSLRYLWILECHPVLKERCQENVGLDWPKIAHIPNVWIE 1208 >ref|XP_020082499.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] ref|XP_020082500.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] ref|XP_020082501.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] Length = 1221 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L + +A L+QS+P LP+SL L I+ C+ L +RCQ+ G DWP I HI N+WI+ Sbjct: 1154 LKVNDANLIQSLPNLPTSLRYLWILECHPVLKERCQENVGLDWPKIAHIPNVWIE 1208 >ref|XP_020098649.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] ref|XP_020098650.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] ref|XP_020098651.1| disease resistance protein RGA2-like isoform X1 [Ananas comosus] Length = 1222 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 4 LSLAEARLLQSVPRLPSSLERLAIVGCNETLMDRCQKEEGADWPNINHICNIWID 168 L + +A L+QS+P LP+SL L I+ C+ L +RCQ+ G DWP I HI N+WI+ Sbjct: 1155 LKVNDANLIQSLPNLPTSLRYLWILECHPVLKERCQENVGLDWPKIAHIPNVWIE 1209