BLASTX nr result
ID: Ophiopogon25_contig00019077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00019077 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 72 1e-13 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 72.0 bits (175), Expect = 1e-13 Identities = 33/42 (78%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +3 Query: 381 DFSRDSV-INMSWIMLRIDYSRLFWLLFGVFSYENHEGKPRI 503 +FSR +V + ++WIMLRIDYSRL WLLFGVFSYENHEGKPRI Sbjct: 19 EFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRI 60