BLASTX nr result
ID: Ophiopogon25_contig00018895
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018895 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY68076.1| hypothetical protein ACMD2_14701 [Ananas comosus] 54 8e-06 ref|XP_020098840.1| uncharacterized protein LOC109717448 [Ananas... 54 8e-06 >gb|OAY68076.1| hypothetical protein ACMD2_14701 [Ananas comosus] Length = 508 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 2 HIRADQAAALGKIQDALKHLGYVILSTSMPTV 97 H+RADQ +ALGKIQDAL++L YV+LSTSMP+V Sbjct: 477 HLRADQTSALGKIQDALQYLAYVVLSTSMPSV 508 >ref|XP_020098840.1| uncharacterized protein LOC109717448 [Ananas comosus] Length = 528 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 2 HIRADQAAALGKIQDALKHLGYVILSTSMPTV 97 H+RADQ +ALGKIQDAL++L YV+LSTSMP+V Sbjct: 497 HLRADQTSALGKIQDALQYLAYVVLSTSMPSV 528