BLASTX nr result
ID: Ophiopogon25_contig00018691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018691 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ74765.1| putative Pentatricopeptide repeat-containing prot... 55 2e-06 >gb|KMZ74765.1| putative Pentatricopeptide repeat-containing protein [Zostera marina] Length = 274 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +1 Query: 253 RFTNSPASFDWSXXXXXXAQEPDAKTLSKPQQIDKSKLPPPYDPFSKK 396 RFTN+ ASFDWS ++ ++KT S P IDK+KLPPPYDPF+KK Sbjct: 39 RFTNTEASFDWSDSDDE-GKKGESKT-SSPAVIDKTKLPPPYDPFNKK 84