BLASTX nr result
ID: Ophiopogon25_contig00018635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018635 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75855.1| uncharacterized protein A4U43_C03F21260 [Asparagu... 59 3e-07 ref|XP_020258721.1| formin-like protein 20 [Asparagus officinalis] 59 4e-07 >gb|ONK75855.1| uncharacterized protein A4U43_C03F21260 [Asparagus officinalis] Length = 1461 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -1 Query: 449 PSSVSRSEAFSRVPPPPLSRLIWNKSDVPPSSFPLAPQVGISQDP 315 P S S+ SRV PPPLSRLIW KSD P SFPLAPQ SQ P Sbjct: 1098 PPSPSQKVTSSRVAPPPLSRLIWKKSDTPSPSFPLAPQAENSQGP 1142 >ref|XP_020258721.1| formin-like protein 20 [Asparagus officinalis] Length = 2135 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -1 Query: 449 PSSVSRSEAFSRVPPPPLSRLIWNKSDVPPSSFPLAPQVGISQDP 315 P S S+ SRV PPPLSRLIW KSD P SFPLAPQ SQ P Sbjct: 1166 PPSPSQKVTSSRVAPPPLSRLIWKKSDTPSPSFPLAPQAENSQGP 1210