BLASTX nr result
ID: Ophiopogon25_contig00018511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018511 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244127.1| deSI-like protein At4g17486 [Asparagus offic... 62 6e-09 >ref|XP_020244127.1| deSI-like protein At4g17486 [Asparagus officinalis] gb|ONK59128.1| uncharacterized protein A4U43_C08F3280 [Asparagus officinalis] Length = 219 Score = 62.0 bits (149), Expect = 6e-09 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 5/58 (8%) Frame = -1 Query: 393 PEHLELSDGSESIA-SSMEES---NVDAHQHLLPS-TSETSTAREKSVRLVKDHFTSD 235 PEHLELSDGSESIA SSMEES + D QHLLP+ SE S+AREK V+L +D TS+ Sbjct: 160 PEHLELSDGSESIASSSMEESDDDDEDGRQHLLPAPRSEPSSAREKPVKLARDLLTSE 217