BLASTX nr result
ID: Ophiopogon25_contig00018455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018455 (712 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019703522.1| PREDICTED: protein root UVB sensitive 6-like... 61 5e-07 ref|XP_017698000.1| PREDICTED: protein root UVB sensitive 6-like... 61 5e-07 ref|XP_019703521.1| PREDICTED: protein root UVB sensitive 6-like... 61 5e-07 ref|XP_008808962.2| PREDICTED: LOW QUALITY PROTEIN: protein root... 59 2e-06 ref|XP_020261927.1| protein root UVB sensitive 6 [Asparagus offi... 59 2e-06 ref|XP_010930369.1| PREDICTED: protein root UVB sensitive 6 [Ela... 59 3e-06 gb|KQK06209.1| hypothetical protein BRADI_2g25111v3 [Brachypodiu... 53 5e-06 ref|XP_020104409.1| protein root UVB sensitive 6 [Ananas comosus] 58 5e-06 gb|ACL52948.1| unknown [Zea mays] 52 7e-06 >ref|XP_019703522.1| PREDICTED: protein root UVB sensitive 6-like isoform X2 [Elaeis guineensis] Length = 523 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKE 90 VFK+KAA+QGWIMS+SLLNPGRARLCELKE Sbjct: 493 VFKRKAAEQGWIMSDSLLNPGRARLCELKE 522 >ref|XP_017698000.1| PREDICTED: protein root UVB sensitive 6-like [Phoenix dactylifera] Length = 523 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKE 90 VFK+KAA+QGWIMS+SLLNPGRARLCELKE Sbjct: 493 VFKRKAAEQGWIMSDSLLNPGRARLCELKE 522 >ref|XP_019703521.1| PREDICTED: protein root UVB sensitive 6-like isoform X1 [Elaeis guineensis] Length = 529 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKE 90 VFK+KAA+QGWIMS+SLLNPGRARLCELKE Sbjct: 499 VFKRKAAEQGWIMSDSLLNPGRARLCELKE 528 >ref|XP_008808962.2| PREDICTED: LOW QUALITY PROTEIN: protein root UVB sensitive 6 [Phoenix dactylifera] Length = 514 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 4 FKKKAADQGWIMSESLLNPGRARLCELKE 90 FKKKAA+QGWIMSESLLNPGRARLC LKE Sbjct: 485 FKKKAAEQGWIMSESLLNPGRARLCGLKE 513 >ref|XP_020261927.1| protein root UVB sensitive 6 [Asparagus officinalis] gb|ONK73081.1| uncharacterized protein A4U43_C04F26960 [Asparagus officinalis] Length = 515 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKEL 93 VFKKKAAD+GW+MSESLLNPGRARL E+KEL Sbjct: 485 VFKKKAADEGWVMSESLLNPGRARLREVKEL 515 >ref|XP_010930369.1| PREDICTED: protein root UVB sensitive 6 [Elaeis guineensis] Length = 514 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 4 FKKKAADQGWIMSESLLNPGRARLCELKE 90 FKKKAA+QGWIMS+SLLNPGRARLC LKE Sbjct: 485 FKKKAAEQGWIMSDSLLNPGRARLCRLKE 513 >gb|KQK06209.1| hypothetical protein BRADI_2g25111v3 [Brachypodium distachyon] Length = 50 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKEL 93 +FK+KA +QGWIMSESLLNPGRARLC + L Sbjct: 20 IFKRKAREQGWIMSESLLNPGRARLCGIVPL 50 >ref|XP_020104409.1| protein root UVB sensitive 6 [Ananas comosus] Length = 523 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VFKKKAADQGWIMSESLLNPGRARLCELKE 90 VFK+KAA++GWIMSESLLNPGRARLC LKE Sbjct: 493 VFKEKAAEEGWIMSESLLNPGRARLCGLKE 522 >gb|ACL52948.1| unknown [Zea mays] Length = 50 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 4 FKKKAADQGWIMSESLLNPGRARLCELK 87 FKKKA +QGWIMSESLLNPG+ARLC K Sbjct: 21 FKKKAREQGWIMSESLLNPGKARLCAAK 48