BLASTX nr result
ID: Ophiopogon25_contig00018223
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018223 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245797.1| LOW QUALITY PROTEIN: branchpoint-bridging pr... 56 2e-06 >ref|XP_020245797.1| LOW QUALITY PROTEIN: branchpoint-bridging protein-like [Asparagus officinalis] Length = 553 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = -3 Query: 295 QGIANAPWASNXXXXXXXXXXXPSTEQPTGYGGDTEYEKFMSEMK 161 QGIAN PWASN + EQP YGGDTEYEKFMSEMK Sbjct: 511 QGIANVPWASNPPSQPPRSQP--AAEQPASYGGDTEYEKFMSEMK 553