BLASTX nr result
ID: Ophiopogon25_contig00018217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018217 (864 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264148.1| flowering time control protein FPA [Asparagu... 81 2e-13 >ref|XP_020264148.1| flowering time control protein FPA [Asparagus officinalis] gb|ONK68115.1| uncharacterized protein A4U43_C05F7600 [Asparagus officinalis] Length = 950 Score = 81.3 bits (199), Expect = 2e-13 Identities = 47/93 (50%), Positives = 53/93 (56%) Frame = +2 Query: 2 QSGNPCSQSGDSKQTNLPQNPISQPQPSFPPAQGFPNAPQAXXXXXXXXXXXXXXXXXXA 181 QSGN QSGD+ Q NLPQ P SQ S P Q FP APQ A Sbjct: 839 QSGN--LQSGDNGQLNLPQVPSSQSHTSLPQIQLFPRAPQPTMGQQVSQLPQLQKQVPSA 896 Query: 182 TASQQPIENPMQLSSHQASNDSREEAEADPQKR 280 + QQPIENP+Q S+ QASN++ EE EADPQKR Sbjct: 897 STMQQPIENPVQQSNQQASNNNGEETEADPQKR 929