BLASTX nr result
ID: Ophiopogon25_contig00018064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00018064 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021801082.1| ubiquitin carboxyl-terminal hydrolase 3-like... 55 2e-06 gb|OUZ99346.1| Ubiquitin carboxyl-terminal hydrolases family 2 [... 58 4e-06 ref|XP_020257431.1| ubiquitin carboxyl-terminal hydrolase 3 [Asp... 57 8e-06 ref|XP_019177326.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 8e-06 ref|XP_010645222.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 9e-06 gb|ACU13621.1| unknown [Glycine max] 55 1e-05 >ref|XP_021801082.1| ubiquitin carboxyl-terminal hydrolase 3-like [Prunus avium] Length = 116 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 669 EITSQKKKIGAIAPKNFVHRVQKENELFRSYMHWV 565 +I+SQKKK G IAPK FV R++K+NELFRSYMH V Sbjct: 78 QISSQKKKTGVIAPKRFVQRLKKQNELFRSYMHQV 112 >gb|OUZ99346.1| Ubiquitin carboxyl-terminal hydrolases family 2 [Macleaya cordata] Length = 438 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 669 EITSQKKKIGAIAPKNFVHRVQKENELFRSYMH 571 EI+SQKKK G IAPK FV RV+KENELFRSYMH Sbjct: 145 EISSQKKKTGVIAPKRFVQRVKKENELFRSYMH 177 >ref|XP_020257431.1| ubiquitin carboxyl-terminal hydrolase 3 [Asparagus officinalis] gb|ONK75556.1| uncharacterized protein A4U43_C03F18130 [Asparagus officinalis] Length = 366 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 669 EITSQKKKIGAIAPKNFVHRVQKENELFRSYMH 571 +I+SQKKK G IAPK FV RV+KENELFRSYMH Sbjct: 78 QISSQKKKTGVIAPKRFVQRVKKENELFRSYMH 110 >ref|XP_019177326.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Ipomoea nil] Length = 370 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 669 EITSQKKKIGAIAPKNFVHRVQKENELFRSYMH 571 +I+SQKKK G IAPK FVHR++K+NE+FRSYMH Sbjct: 78 QISSQKKKTGVIAPKRFVHRLKKQNEIFRSYMH 110 >ref|XP_010645222.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3 isoform X2 [Vitis vinifera] Length = 302 Score = 56.6 bits (135), Expect = 9e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 672 EEITSQKKKIGAIAPKNFVHRVQKENELFRSYMH 571 E+I+SQKKK G IAPK FV R++K+NELFRSYMH Sbjct: 10 EQISSQKKKTGVIAPKRFVQRLKKQNELFRSYMH 43 >gb|ACU13621.1| unknown [Glycine max] Length = 155 Score = 54.7 bits (130), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 669 EITSQKKKIGAIAPKNFVHRVQKENELFRSYMH 571 +I+SQKKK G IAPK FV R++K+NELFRSYMH Sbjct: 78 QISSQKKKTGVIAPKRFVQRLKKQNELFRSYMH 110