BLASTX nr result
ID: Ophiopogon25_contig00017898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017898 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA26504.1| hypothetical protein AQUCO_09200010v1 [Aquilegia ... 56 1e-07 ref|XP_009788850.1| PREDICTED: uncharacterized protein LOC104236... 52 3e-06 gb|OMP03199.1| hypothetical protein COLO4_10585 [Corchorus olito... 52 3e-06 ref|XP_006380852.1| hypothetical protein POPTR_0007s15330g [Popu... 51 4e-06 gb|PIN19747.1| hypothetical protein CDL12_07571 [Handroanthus im... 52 5e-06 >gb|PIA26504.1| hypothetical protein AQUCO_09200010v1 [Aquilegia coerulea] Length = 97 Score = 55.8 bits (133), Expect = 1e-07 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = +3 Query: 144 RHLMWKVRSQWRLVVKPSRQSRVRFGYDPESYSLNFDDGCF 266 R ++W++R+ + VVK + RV+F YDP SY+LNFDDGCF Sbjct: 23 RRVLWRLRAAMKKVVKNGSKKRVKFEYDPSSYALNFDDGCF 63 >ref|XP_009788850.1| PREDICTED: uncharacterized protein LOC104236594 [Nicotiana sylvestris] Length = 95 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +3 Query: 144 RHLMWKVRSQWRLVVKPSRQSRVRFGYDPESYSLNFDDGC 263 R L W+++S+WR ++ R+S VRF YDP SYS NFDDGC Sbjct: 46 RQLYWRLKSRWRQLLS-WRRSSVRFSYDPYSYSQNFDDGC 84 >gb|OMP03199.1| hypothetical protein COLO4_10585 [Corchorus olitorius] Length = 98 Score = 52.4 bits (124), Expect = 3e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +3 Query: 141 MRHLMWKVRSQWRLVVKPSRQSRVRFGYDPESYSLNFDDG 260 ++ LMWK++SQW+ +K R + +F YD SYSLNFDDG Sbjct: 45 LKQLMWKLKSQWKQAMKMQRNTSRQFSYDLHSYSLNFDDG 84 >ref|XP_006380852.1| hypothetical protein POPTR_0007s15330g [Populus trichocarpa] Length = 67 Score = 51.2 bits (121), Expect = 4e-06 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +3 Query: 111 SRLVMAWTATMRHLMWKVRSQWRLVVKPSR-QSRVRFGYDPESYSLNFDDGCF 266 +R+V+ +R L W+VR++ R VK S+ + R+ F YDP SY+LNFDDG F Sbjct: 11 NRVVLCGKRKLRSLFWRVRAEIRRQVKSSKSKQRLSFNYDPFSYALNFDDGNF 63 >gb|PIN19747.1| hypothetical protein CDL12_07571 [Handroanthus impetiginosus] Length = 90 Score = 51.6 bits (122), Expect = 5e-06 Identities = 20/40 (50%), Positives = 28/40 (70%) Frame = +3 Query: 144 RHLMWKVRSQWRLVVKPSRQSRVRFGYDPESYSLNFDDGC 263 R L+W++RS + VK + + +F YDP SY+LNFDDGC Sbjct: 19 RSLLWRIRSAMKRTVKNGSKQKFKFQYDPHSYALNFDDGC 58