BLASTX nr result
ID: Ophiopogon25_contig00017826
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017826 (960 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU86149.1| ubiquitin-conjugating enzyme E2 S [Dendrobium cat... 43 4e-06 >gb|PKU86149.1| ubiquitin-conjugating enzyme E2 S [Dendrobium catenatum] Length = 221 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = +3 Query: 153 DWY-----RLAYAKYITPLPSKDQWVTCEKDYKLGAPHSRMPRGRSKVK 284 DWY R+AY I LP KDQW+ + +G P + PRGR K K Sbjct: 97 DWYFVYRYRMAYEGAIGTLPDKDQWLVVQNVVDIGVPSTSRPRGRPKKK 145 Score = 37.0 bits (84), Expect(2) = 4e-06 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 8/49 (16%) Frame = +1 Query: 352 KRIHKCARCHEYSHQRNTGKRP--------INPRADPLPQQPLMTPKLT 474 K++HKC+RC + H R+T K P I R +PLP++ + + T Sbjct: 155 KKVHKCSRCSLWGHHRSTCKNPLQKINDVAITQRMNPLPKRSKLESRRT 203