BLASTX nr result
ID: Ophiopogon25_contig00017778
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017778 (614 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246023.1| uncharacterized protein At4g14100-like [Aspa... 57 8e-07 >ref|XP_020246023.1| uncharacterized protein At4g14100-like [Asparagus officinalis] gb|ONK58638.1| uncharacterized protein A4U43_C09F15110 [Asparagus officinalis] Length = 167 Score = 57.4 bits (137), Expect = 8e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 595 GISTHVITFEAGAELDDSEWQAPSVCFTDSNVSQNGERGQELEVIK 458 GIS+HV+TFE GA L+DSEWQAPS CFTD+ G +L+ ++ Sbjct: 112 GISSHVMTFEVGATLEDSEWQAPSYCFTDNRREGGGMNTSDLQDLR 157