BLASTX nr result
ID: Ophiopogon25_contig00017690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017690 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261873.1| uncharacterized protein LOC109837901 [Aspara... 53 3e-06 ref|XP_020249406.1| uncharacterized protein LOC109826797 [Aspara... 52 3e-06 >ref|XP_020261873.1| uncharacterized protein LOC109837901 [Asparagus officinalis] Length = 127 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +1 Query: 187 SYHEQVCRHNLRARIGKSTTEKNPDRLFWGCEL*KTDNCGFFKWLPKD 330 ++H +C RA + +S T+ NP RLF GC K NCGFFKW+P + Sbjct: 7 NHHGLLCHCGRRAILSRSGTKANPGRLFLGCANWKVSNCGFFKWVPNE 54 >ref|XP_020249406.1| uncharacterized protein LOC109826797 [Asparagus officinalis] Length = 117 Score = 52.4 bits (124), Expect = 3e-06 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = +1 Query: 193 HEQVCRHNLRARIGKSTTEKNPDRLFWGCEL*KTDNCGFFKWL 321 H +C RA + +S T+ NP RLFWGC K NCGFFKW+ Sbjct: 9 HGLMCHCGRRAILSRSGTKTNPGRLFWGCANWKVRNCGFFKWV 51