BLASTX nr result
ID: Ophiopogon25_contig00017628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017628 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020263661.1| FAD synthetase, chloroplastic-like [Asparagu... 64 6e-09 >ref|XP_020263661.1| FAD synthetase, chloroplastic-like [Asparagus officinalis] gb|ONK73692.1| uncharacterized protein A4U43_C04F34280 [Asparagus officinalis] Length = 361 Score = 63.9 bits (154), Expect = 6e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 3 DNVFIAECRVVLDAENLDIELYSGSMQDVIQDGHLISIEFG 125 DN+ +A+CRVVLD ENLDIELY +QDVI DG LIS+EFG Sbjct: 321 DNLIVAKCRVVLDDENLDIELYKEGIQDVIHDGQLISVEFG 361