BLASTX nr result
ID: Ophiopogon25_contig00017072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00017072 (1292 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273090.1| uncharacterized protein LOC109848142 isoform... 97 3e-18 ref|XP_020273085.1| uncharacterized protein LOC109848142 isoform... 97 3e-18 >ref|XP_020273090.1| uncharacterized protein LOC109848142 isoform X2 [Asparagus officinalis] gb|ONK62846.1| uncharacterized protein A4U43_C07F8730 [Asparagus officinalis] Length = 392 Score = 96.7 bits (239), Expect = 3e-18 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 8/89 (8%) Frame = -1 Query: 1292 LYKRIRSLVHQTDGVPIQGNDERIYYHTNTKKKDP--------SKSPYVWYKKSVLLEKS 1137 LYKRIRS+VHQT+ + IQ ND+ IYY ++KK P KSP+ YKK LL KS Sbjct: 304 LYKRIRSIVHQTNEISIQDNDDSIYYTNDSKKNSPFDSNKNNKKKSPFDLYKKCELLAKS 363 Query: 1136 PYELLEISRSSYKCWCSDLRTEMNAMQED 1050 P ELLEIS+SSYKCWC D + +N M E+ Sbjct: 364 PDELLEISKSSYKCWCWDAKRTLNRMIEE 392 >ref|XP_020273085.1| uncharacterized protein LOC109848142 isoform X1 [Asparagus officinalis] ref|XP_020273086.1| uncharacterized protein LOC109848142 isoform X1 [Asparagus officinalis] ref|XP_020273087.1| uncharacterized protein LOC109848142 isoform X1 [Asparagus officinalis] ref|XP_020273088.1| uncharacterized protein LOC109848142 isoform X1 [Asparagus officinalis] ref|XP_020273089.1| uncharacterized protein LOC109848142 isoform X1 [Asparagus officinalis] Length = 397 Score = 96.7 bits (239), Expect = 3e-18 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 8/89 (8%) Frame = -1 Query: 1292 LYKRIRSLVHQTDGVPIQGNDERIYYHTNTKKKDP--------SKSPYVWYKKSVLLEKS 1137 LYKRIRS+VHQT+ + IQ ND+ IYY ++KK P KSP+ YKK LL KS Sbjct: 309 LYKRIRSIVHQTNEISIQDNDDSIYYTNDSKKNSPFDSNKNNKKKSPFDLYKKCELLAKS 368 Query: 1136 PYELLEISRSSYKCWCSDLRTEMNAMQED 1050 P ELLEIS+SSYKCWC D + +N M E+ Sbjct: 369 PDELLEISKSSYKCWCWDAKRTLNRMIEE 397