BLASTX nr result
ID: Ophiopogon25_contig00016723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016723 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244282.1| U1 small nuclear ribonucleoprotein C-like [A... 66 3e-10 >ref|XP_020244282.1| U1 small nuclear ribonucleoprotein C-like [Asparagus officinalis] gb|ONK60140.1| uncharacterized protein A4U43_C08F14810 [Asparagus officinalis] Length = 202 Score = 65.9 bits (159), Expect = 3e-10 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +2 Query: 2 PLAPGVPNAPTSNGATTLNNTVTYQAGPSFSSGPSTAPIGTTNSQDGFVYSQAS 163 P PG APT N A NTVTYQA PSF+SG STAP G+TNSQ+ F YSQ S Sbjct: 152 PPVPGATTAPTPNSAM---NTVTYQANPSFTSGSSTAPAGSTNSQETFAYSQNS 202