BLASTX nr result
ID: Ophiopogon25_contig00016709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016709 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS47727.1| putative potassium transporter 17 [Triticum urartu] 59 3e-07 >gb|EMS47727.1| putative potassium transporter 17 [Triticum urartu] Length = 682 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 24/66 (36%) Frame = +2 Query: 359 VLVLSAIDGLREPFPSVGKR------------------------LWTLTTPMIGVYSFLR 466 + VLSAIDGLR PFPSV KR WT TTP++G+YS +R Sbjct: 162 ISVLSAIDGLRGPFPSVSKRSCCGSSICSNSYWLILSAKIWDFKTWTFTTPIVGIYSIVR 221 Query: 467 YYPGIF 484 YYPGIF Sbjct: 222 YYPGIF 227