BLASTX nr result
ID: Ophiopogon25_contig00016630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016630 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010930996.1| PREDICTED: autophagy-related protein 13b-lik... 57 1e-06 ref|XP_010912404.1| PREDICTED: autophagy-related protein 13b [El... 56 2e-06 ref|XP_020253217.1| autophagy-related protein 13b-like isoform X... 55 4e-06 >ref|XP_010930996.1| PREDICTED: autophagy-related protein 13b-like isoform X1 [Elaeis guineensis] ref|XP_010930997.1| PREDICTED: autophagy-related protein 13b-like isoform X1 [Elaeis guineensis] Length = 684 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 3 SGSMITASGLSRSRTAADALEELKRFKEMKELLLRQSGSQSLD 131 S S ITASGL + RT ADAL EL+ +KEMKELL++Q GSQS D Sbjct: 629 SSSGITASGLPKPRTTADALAELRSYKEMKELLVKQGGSQSSD 671 >ref|XP_010912404.1| PREDICTED: autophagy-related protein 13b [Elaeis guineensis] Length = 685 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 3 SGSMITASGLSRSRTAADALEELKRFKEMKELLLRQSGSQSL 128 S S ITASG S+ RT AD LEEL+ +KEMKELLL+Q GS+SL Sbjct: 630 SNSEITASGPSKPRTTADGLEELRIYKEMKELLLKQGGSKSL 671 >ref|XP_020253217.1| autophagy-related protein 13b-like isoform X1 [Asparagus officinalis] gb|ONK77535.1| uncharacterized protein A4U43_C02F7580 [Asparagus officinalis] Length = 652 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +3 Query: 15 ITASGLSRSRTAADALEELKRFKEMKELLLRQSGSQSLDVDVAKI 149 +TASGL RS TAADAL+ELK +K+MKE L+Q G QSL+V +I Sbjct: 599 VTASGLLRSMTAADALKELKNYKQMKESFLKQGGLQSLNVQQEEI 643