BLASTX nr result
ID: Ophiopogon25_contig00016537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016537 (728 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagu... 58 3e-06 >gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagus officinalis] Length = 292 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 177 SPEWLDLPVPLTELILERLPLSDYVRSATVCRKWRSVQ 290 SP WLDLP TELIL+RLPL DY+R A VC KW+S+Q Sbjct: 161 SPPWLDLPDLATELILQRLPLPDYIRFADVCIKWQSIQ 198