BLASTX nr result
ID: Ophiopogon25_contig00016534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016534 (769 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI32166.1| hypothetical protein CRG98_047443 [Punica granatum] 55 4e-06 >gb|PKI32166.1| hypothetical protein CRG98_047443 [Punica granatum] Length = 119 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 1 EEREYMSHVPYVSAVGSLMYAMVCTRLDP*LSISDDSGYRSYDSL 135 EERE M+HVPY SA+GSLMYAM+CTR D ++S S Y+S L Sbjct: 7 EEREKMAHVPYASAIGSLMYAMLCTRSDIAYAVSMTSRYQSNPGL 51