BLASTX nr result
ID: Ophiopogon25_contig00016531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016531 (656 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020591109.1| bet1-like SNARE 1-1 isoform X1 [Phalaenopsis... 81 6e-16 ref|XP_020678462.1| bet1-like SNARE 1-1 [Dendrobium catenatum] >... 79 3e-15 ref|XP_020112997.1| bet1-like SNARE 1-1 isoform X1 [Ananas comos... 77 2e-14 ref|XP_009383972.1| PREDICTED: bet1-like SNARE 1-1 [Musa acumina... 77 2e-14 ref|XP_008779394.1| PREDICTED: bet1-like SNARE 1-1 isoform X2 [P... 76 2e-14 ref|XP_020591111.1| bet1-like SNARE 1-1 isoform X2 [Phalaenopsis... 75 6e-14 ref|XP_020112999.1| bet1-like SNARE 1-1 isoform X2 [Ananas comos... 75 6e-14 ref|XP_008779381.1| PREDICTED: bet1-like SNARE 1-1 isoform X1 [P... 75 6e-14 ref|XP_008787405.1| PREDICTED: bet1-like SNARE 1-1 [Phoenix dact... 75 9e-14 ref|XP_010940593.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guine... 74 3e-13 ref|XP_018676987.1| PREDICTED: bet1-like SNARE 1-1 isoform X3 [M... 74 3e-13 ref|XP_018676986.1| PREDICTED: bet1-like SNARE 1-1 isoform X2 [M... 74 4e-13 ref|XP_010933097.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guine... 73 5e-13 ref|XP_020275849.1| bet1-like SNARE 1-1 [Asparagus officinalis] ... 73 6e-13 ref|XP_018676984.1| PREDICTED: bet1-like SNARE 1-1 isoform X1 [M... 74 7e-13 gb|PKA64738.1| Bet1-like SNARE 1-1 [Apostasia shenzhenica] 74 1e-12 ref|XP_010935763.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guine... 72 1e-12 ref|XP_007200626.1| bet1-like SNARE 1-1 [Prunus persica] >gi|645... 72 1e-12 ref|XP_002262985.1| PREDICTED: bet1-like SNARE 1-1 [Vitis vinife... 72 1e-12 ref|XP_010918774.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guine... 72 2e-12 >ref|XP_020591109.1| bet1-like SNARE 1-1 isoform X1 [Phalaenopsis equestris] Length = 122 Score = 80.9 bits (198), Expect = 6e-16 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 DHRSNRAALFD +EEG ++A+ Y S+EIDEHDND AVD LQDRVNILKR Sbjct: 6 DHRSNRAALFDGIEEGGIRATSYSSHEIDEHDNDLAVDGLQDRVNILKR 54 >ref|XP_020678462.1| bet1-like SNARE 1-1 [Dendrobium catenatum] ref|XP_020678463.1| bet1-like SNARE 1-1 [Dendrobium catenatum] gb|PKU72076.1| Bet1-like SNARE 1-1 [Dendrobium catenatum] Length = 122 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RS+RAALFD +EEG ++AS Y S EIDEHDNDRAVD LQDRVNILKR Sbjct: 6 DYRSSRAALFDGIEEGGIRASSYSSNEIDEHDNDRAVDGLQDRVNILKR 54 >ref|XP_020112997.1| bet1-like SNARE 1-1 isoform X1 [Ananas comosus] ref|XP_020112998.1| bet1-like SNARE 1-1 isoform X1 [Ananas comosus] gb|OAY75788.1| Bet1-like SNARE 1-1 [Ananas comosus] Length = 122 Score = 77.0 bits (188), Expect = 2e-14 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 ++RSNRAALFD +EEG ++AS Y S+EIDEH+NDRA++ LQDRVNILKR Sbjct: 6 EYRSNRAALFDGIEEGGIRASTYSSHEIDEHENDRAIEGLQDRVNILKR 54 >ref|XP_009383972.1| PREDICTED: bet1-like SNARE 1-1 [Musa acuminata subsp. malaccensis] ref|XP_009383980.1| PREDICTED: bet1-like SNARE 1-1 [Musa acuminata subsp. malaccensis] Length = 122 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 DHRSNRAALFD +EEG ++AS Y S+EI EHDND A++ LQDRVNILKR Sbjct: 6 DHRSNRAALFDGIEEGGIRASAYSSHEIHEHDNDLAIEGLQDRVNILKR 54 >ref|XP_008779394.1| PREDICTED: bet1-like SNARE 1-1 isoform X2 [Phoenix dactylifera] Length = 103 Score = 76.3 bits (186), Expect = 2e-14 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKRTDCRQTDNAL 332 D+RS RAALFD +EEG ++AS Y S+EIDEH+ND+AV+ LQDRVNILKR + T + Sbjct: 6 DYRSTRAALFDGIEEGGIRASSYSSHEIDEHENDQAVEGLQDRVNILKRGNDMDTSRGI 64 >ref|XP_020591111.1| bet1-like SNARE 1-1 isoform X2 [Phalaenopsis equestris] Length = 118 Score = 75.5 bits (184), Expect = 6e-14 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 502 RSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 RSNRAALFD +EEG ++A+ Y S+EIDEHDND AVD LQDRVNILKR Sbjct: 4 RSNRAALFDGIEEGGIRATSYSSHEIDEHDNDLAVDGLQDRVNILKR 50 >ref|XP_020112999.1| bet1-like SNARE 1-1 isoform X2 [Ananas comosus] ref|XP_020113000.1| bet1-like SNARE 1-1 isoform X2 [Ananas comosus] Length = 118 Score = 75.5 bits (184), Expect = 6e-14 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 502 RSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 RSNRAALFD +EEG ++AS Y S+EIDEH+NDRA++ LQDRVNILKR Sbjct: 4 RSNRAALFDGIEEGGIRASTYSSHEIDEHENDRAIEGLQDRVNILKR 50 >ref|XP_008779381.1| PREDICTED: bet1-like SNARE 1-1 isoform X1 [Phoenix dactylifera] Length = 122 Score = 75.5 bits (184), Expect = 6e-14 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RS RAALFD +EEG ++AS Y S+EIDEH+ND+AV+ LQDRVNILKR Sbjct: 6 DYRSTRAALFDGIEEGGIRASSYSSHEIDEHENDQAVEGLQDRVNILKR 54 >ref|XP_008787405.1| PREDICTED: bet1-like SNARE 1-1 [Phoenix dactylifera] ref|XP_008787406.1| PREDICTED: bet1-like SNARE 1-1 [Phoenix dactylifera] ref|XP_008787407.1| PREDICTED: bet1-like SNARE 1-1 [Phoenix dactylifera] ref|XP_008787408.1| PREDICTED: bet1-like SNARE 1-1 [Phoenix dactylifera] Length = 122 Score = 75.1 bits (183), Expect = 9e-14 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RS RAALFD +EEG ++AS Y S+EIDEH++DRAV+ LQDRVNILKR Sbjct: 6 DYRSTRAALFDGIEEGGIRASSYSSHEIDEHEDDRAVEGLQDRVNILKR 54 >ref|XP_010940593.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] ref|XP_010940594.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] Length = 122 Score = 73.6 bits (179), Expect = 3e-13 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+R RAALFD +EEG ++AS Y S+EIDEH+ND+A++ LQDRVNILKR Sbjct: 6 DYRGTRAALFDGIEEGGIRASSYSSHEIDEHENDQAIEGLQDRVNILKR 54 >ref|XP_018676987.1| PREDICTED: bet1-like SNARE 1-1 isoform X3 [Musa acuminata subsp. malaccensis] Length = 122 Score = 73.6 bits (179), Expect = 3e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+ SNR ALFD +EEG V+AS Y S+EIDEHDND A++ LQDRVNILKR Sbjct: 6 DYHSNRTALFDGIEEGGVRASAYSSHEIDEHDNDLAMEGLQDRVNILKR 54 >ref|XP_018676986.1| PREDICTED: bet1-like SNARE 1-1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 131 Score = 73.6 bits (179), Expect = 4e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+ SNR ALFD +EEG V+AS Y S+EIDEHDND A++ LQDRVNILKR Sbjct: 6 DYHSNRTALFDGIEEGGVRASAYSSHEIDEHDNDLAMEGLQDRVNILKR 54 >ref|XP_010933097.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] ref|XP_010933098.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] ref|XP_019709083.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] Length = 120 Score = 73.2 bits (178), Expect = 5e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RSNRAALF+ +EEG ++A Y S+EIDEHDNDRA+D LQDRVNILKR Sbjct: 6 DYRSNRAALFNGLEEGGIRA--YSSHEIDEHDNDRAIDGLQDRVNILKR 52 >ref|XP_020275849.1| bet1-like SNARE 1-1 [Asparagus officinalis] gb|ONK79475.1| uncharacterized protein A4U43_C01F6740 [Asparagus officinalis] Length = 120 Score = 72.8 bits (177), Expect = 6e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RSNRAALFD +EEG ++A Y S+EIDEH+N+RAVD LQDRVNILKR Sbjct: 6 DNRSNRAALFDGIEEGGIRA--YSSHEIDEHENERAVDGLQDRVNILKR 52 >ref|XP_018676984.1| PREDICTED: bet1-like SNARE 1-1 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018676985.1| PREDICTED: bet1-like SNARE 1-1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 150 Score = 73.6 bits (179), Expect = 7e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+ SNR ALFD +EEG V+AS Y S+EIDEHDND A++ LQDRVNILKR Sbjct: 6 DYHSNRTALFDGIEEGGVRASAYSSHEIDEHDNDLAMEGLQDRVNILKR 54 >gb|PKA64738.1| Bet1-like SNARE 1-1 [Apostasia shenzhenica] Length = 191 Score = 73.9 bits (180), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RS+R ALFD +EEG ++AS Y S EIDEHDNDRA+D L DRVNILKR Sbjct: 75 DYRSSRNALFDGIEEGGIRASPYSSCEIDEHDNDRAIDGLHDRVNILKR 123 >ref|XP_010935763.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] Length = 122 Score = 72.0 bits (175), Expect = 1e-12 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILK 365 D+RS RAALFD +EEG +QAS Y S+EIDEH+NDR ++ LQ RVNILK Sbjct: 6 DYRSTRAALFDGIEEGGIQASSYSSHEIDEHENDRTIEGLQGRVNILK 53 >ref|XP_007200626.1| bet1-like SNARE 1-1 [Prunus persica] ref|XP_008235716.1| PREDICTED: bet1-like SNARE 1-1 [Prunus mume] ref|XP_008235717.1| PREDICTED: bet1-like SNARE 1-1 [Prunus mume] ref|XP_020425930.1| bet1-like SNARE 1-1 [Prunus persica] ref|XP_021814802.1| bet1-like SNARE 1-1 [Prunus avium] ref|XP_021814803.1| bet1-like SNARE 1-1 [Prunus avium] gb|ONH93349.1| hypothetical protein PRUPE_8G227800 [Prunus persica] Length = 122 Score = 72.0 bits (175), Expect = 1e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+R N+ ALFD +EEG ++AS S+EIDEHDN+RAVD LQDRVN+LKR Sbjct: 6 DYRGNKVALFDGIEEGGIRASASYSHEIDEHDNERAVDGLQDRVNLLKR 54 >ref|XP_002262985.1| PREDICTED: bet1-like SNARE 1-1 [Vitis vinifera] emb|CBI37085.3| unnamed protein product, partial [Vitis vinifera] Length = 123 Score = 72.0 bits (175), Expect = 1e-12 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASH-YMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+R NR ALFD +EEG ++AS Y S+EIDEHDN+RAVD LQDRVN+LKR Sbjct: 6 DYRGNRIALFDGIEEGGIRASSSYSSHEIDEHDNERAVDGLQDRVNLLKR 55 >ref|XP_010918774.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] ref|XP_010918775.1| PREDICTED: bet1-like SNARE 1-1 [Elaeis guineensis] Length = 120 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 508 DHRSNRAALFDAVEEGRVQASHYMSYEIDEHDNDRAVDVLQDRVNILKR 362 D+RSNRAALFD +EEG ++A Y S+EIDE DNDRA+D LQDRVNILKR Sbjct: 6 DYRSNRAALFDGIEEGGIRA--YSSHEIDELDNDRAIDGLQDRVNILKR 52