BLASTX nr result
ID: Ophiopogon25_contig00016114
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016114 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264594.1| uncharacterized protein LOC109840381 [Aspara... 63 1e-08 gb|PKU72958.1| hypothetical protein MA16_Dca007521 [Dendrobium c... 54 8e-06 ref|XP_020685653.1| uncharacterized protein LOC110101898 [Dendro... 54 9e-06 ref|XP_020582577.1| uncharacterized protein LOC110026116 [Phalae... 54 9e-06 >ref|XP_020264594.1| uncharacterized protein LOC109840381 [Asparagus officinalis] gb|ONK69529.1| uncharacterized protein A4U43_C05F23940 [Asparagus officinalis] Length = 393 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = +2 Query: 269 AQFNIQRLSFEVEKVVVTLEEAKRALQEIINRGH-RLQDRS 388 AQFNIQRLSFEVEK V TLEEAKRALQEI++RG +LQDRS Sbjct: 353 AQFNIQRLSFEVEKGVETLEEAKRALQEIVSRGQPKLQDRS 393 >gb|PKU72958.1| hypothetical protein MA16_Dca007521 [Dendrobium catenatum] Length = 291 Score = 54.3 bits (129), Expect = 8e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 269 AQFNIQRLSFEVEKVVVTLEEAKRALQEIINRG 367 AQFNIQRLSFEVE V TLEEAK+ALQ+IINRG Sbjct: 252 AQFNIQRLSFEVEHGVGTLEEAKKALQKIINRG 284 >ref|XP_020685653.1| uncharacterized protein LOC110101898 [Dendrobium catenatum] Length = 344 Score = 54.3 bits (129), Expect = 9e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 269 AQFNIQRLSFEVEKVVVTLEEAKRALQEIINRG 367 AQFNIQRLSFEVE V TLEEAK+ALQ+IINRG Sbjct: 305 AQFNIQRLSFEVEHGVGTLEEAKKALQKIINRG 337 >ref|XP_020582577.1| uncharacterized protein LOC110026116 [Phalaenopsis equestris] Length = 381 Score = 54.3 bits (129), Expect = 9e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 269 AQFNIQRLSFEVEKVVVTLEEAKRALQEIINRG 367 AQFNIQRLSFEVE V TLEEAK+ALQ+IINRG Sbjct: 340 AQFNIQRLSFEVEHGVGTLEEAKKALQKIINRG 372