BLASTX nr result
ID: Ophiopogon25_contig00016113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016113 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264594.1| uncharacterized protein LOC109840381 [Aspara... 60 3e-07 >ref|XP_020264594.1| uncharacterized protein LOC109840381 [Asparagus officinalis] gb|ONK69529.1| uncharacterized protein A4U43_C05F23940 [Asparagus officinalis] Length = 393 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/41 (80%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -3 Query: 158 AQFNIQRLSFEVEKVVVTLEEAKRALQEIINRGH-RLLDRS 39 AQFNIQRLSFEVEK V TLEEAKRALQEI++RG +L DRS Sbjct: 353 AQFNIQRLSFEVEKGVETLEEAKRALQEIVSRGQPKLQDRS 393