BLASTX nr result
ID: Ophiopogon25_contig00016042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016042 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010922669.1| PREDICTED: pentatricopeptide repeat-containi... 74 8e-12 ref|XP_020244029.1| pentatricopeptide repeat-containing protein ... 73 1e-11 ref|XP_008799833.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_020178592.1| phosphatidylinositol glycan anchor biosynthe... 57 4e-06 ref|XP_018811936.1| PREDICTED: phosphatidylinositol glycan ancho... 57 4e-06 ref|XP_018811935.1| PREDICTED: phosphatidylinositol glycan ancho... 57 4e-06 emb|CDP09802.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_012086988.1| phosphatidylinositol glycan anchor biosynthe... 57 4e-06 dbj|BAK07917.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 6e-06 ref|XP_020248401.1| phosphatidylinositol glycan anchor biosynthe... 57 7e-06 >ref|XP_010922669.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Elaeis guineensis] Length = 489 Score = 73.9 bits (180), Expect = 8e-12 Identities = 38/69 (55%), Positives = 48/69 (69%) Frame = +1 Query: 400 PSCRLSLNKISTRMLRLRLSPYNDKWNQAFTELQAMRTLKKKVMEIENPATSYVAILTDS 579 PSC +S + S + + LSPY KW Q FTELQAM TLKKKV E +N T++++ILTD Sbjct: 4 PSCLVSSS--SMKSWKWPLSPYKGKWQQTFTELQAMETLKKKVSEEKNTPTNFISILTDC 61 Query: 580 FRSNGTDPS 606 FRS +DPS Sbjct: 62 FRSYDSDPS 70 >ref|XP_020244029.1| pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Asparagus officinalis] ref|XP_020244030.1| pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Asparagus officinalis] gb|ONK59991.1| uncharacterized protein A4U43_C08F13060 [Asparagus officinalis] Length = 471 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = +1 Query: 439 MLRLRLSPYNDKWNQAFTELQAMRTLKKKVMEIENPATSYVAILTDSFRSNGTDPS 606 MLR RL P DKW +AF E QA+R LKKKV E++ P+T+Y++IL DSF S GTDP+ Sbjct: 1 MLRCRLYPCEDKWLKAFNEQQALRNLKKKVSEVDKPSTNYLSILNDSFSSCGTDPT 56 >ref|XP_008799833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 489 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = +1 Query: 430 STRMLRLRLSPYNDKWNQAFTELQAMRTLKKKVMEIENPATSYVAILTDSFRSNGTDPS 606 S R + SPY KW Q F+ELQAM TLKKKV E ++ ++++ILTD FRS +DPS Sbjct: 12 SMRSWKWPRSPYKGKWQQTFSELQAMETLKKKVSEEKDTPINFISILTDCFRSYDSDPS 70 >ref|XP_020178592.1| phosphatidylinositol glycan anchor biosynthesis class U protein-like [Aegilops tauschii subsp. tauschii] Length = 453 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR*G 142 TPLTSLR LAEGYWLKQ+ M PYSGSMYH T KR G Sbjct: 37 TPLTSLRRLAEGYWLKQVSMSPYSGSMYHGSPLLLSVLGPLTSKRSG 83 >ref|XP_018811936.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X2 [Juglans regia] Length = 475 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR 136 TPLTSLR LAEGYWLKQL M PY+GSMYH T+KR Sbjct: 47 TPLTSLRRLAEGYWLKQLSMSPYAGSMYHGSPLLLSLLGPLTVKR 91 >ref|XP_018811935.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Juglans regia] Length = 476 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR 136 TPLTSLR LAEGYWLKQL M PY+GSMYH T+KR Sbjct: 47 TPLTSLRRLAEGYWLKQLSMSPYAGSMYHGSPLLLSLLGPLTVKR 91 >emb|CDP09802.1| unnamed protein product [Coffea canephora] Length = 476 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR 136 TPLTSLR LAEGYWLKQL M PY+GSMYH T+KR Sbjct: 58 TPLTSLRRLAEGYWLKQLSMSPYAGSMYHGSPLLLSVLGPLTVKR 102 >ref|XP_012086988.1| phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Jatropha curcas] ref|XP_012086989.1| phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Jatropha curcas] ref|XP_020539657.1| phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Jatropha curcas] Length = 489 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR 136 TPLTSLR LAEGYWLKQL M PY+GSMYH T+KR Sbjct: 52 TPLTSLRRLAEGYWLKQLSMSPYAGSMYHGSPLLLSLLGPLTVKR 96 >dbj|BAK07917.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 451 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR*G 142 TPLTSLR LAEGYWLKQ M PYSGSMYH T KR G Sbjct: 37 TPLTSLRRLAEGYWLKQASMSPYSGSMYHGSPLLLSVLGPLTSKRSG 83 >ref|XP_020248401.1| phosphatidylinositol glycan anchor biosynthesis class U protein-like isoform X1 [Asparagus officinalis] Length = 461 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +2 Query: 2 TPLTSLRLLAEGYWLKQLLMLPYSGSMYHXXXXXXXXXXXXTMKR 136 TPLTSLR LAEGYWLKQ M PYSGSMYH T+KR Sbjct: 39 TPLTSLRRLAEGYWLKQASMSPYSGSMYHGSPLLLPILGPLTVKR 83