BLASTX nr result
ID: Ophiopogon25_contig00016034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00016034 (773 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251742.1| DExH-box ATP-dependent RNA helicase DExH3-li... 65 4e-08 ref|XP_020696726.1| DExH-box ATP-dependent RNA helicase DExH3 [D... 64 6e-08 ref|XP_020570937.1| DExH-box ATP-dependent RNA helicase DExH3 [P... 64 6e-08 ref|XP_010926080.1| PREDICTED: DExH-box ATP-dependent RNA helica... 63 1e-07 ref|XP_008811383.1| PREDICTED: DExH-box ATP-dependent RNA helica... 63 1e-07 gb|PKA49264.1| putative pre-mRNA-splicing factor ATP-dependent R... 63 2e-07 gb|OAY75283.1| ATP-dependent RNA helicase DHX36 [Ananas comosus] 60 1e-06 ref|XP_020088309.1| DExH-box ATP-dependent RNA helicase DExH3-li... 60 1e-06 gb|KHN24317.1| Putative ATP-dependent RNA helicase DHX36 [Glycin... 59 3e-06 ref|XP_009393597.1| PREDICTED: DExH-box ATP-dependent RNA helica... 59 3e-06 ref|XP_016196871.1| DExH-box ATP-dependent RNA helicase DExH3-li... 57 3e-06 ref|XP_015882948.1| PREDICTED: DExH-box ATP-dependent RNA helica... 59 5e-06 dbj|BAS70109.1| Os01g0118100, partial [Oryza sativa Japonica Group] 58 6e-06 dbj|BAD52491.1| putative DEAD/H box polypeptide 36 protein [Oryz... 58 6e-06 ref|XP_015698231.1| PREDICTED: LOW QUALITY PROTEIN: DExH-box ATP... 58 6e-06 ref|XP_022886106.1| DExH-box ATP-dependent RNA helicase DExH3 [O... 58 6e-06 gb|KQK02430.1| hypothetical protein BRADI_2g01360v3 [Brachypodiu... 58 6e-06 ref|XP_004968012.1| DExH-box ATP-dependent RNA helicase DExH3 [S... 58 6e-06 gb|PAN31925.1| hypothetical protein PAHAL_E03838 [Panicum hallii] 58 6e-06 ref|XP_021313012.1| DExH-box ATP-dependent RNA helicase DExH3 [S... 58 6e-06 >ref|XP_020251742.1| DExH-box ATP-dependent RNA helicase DExH3-like [Asparagus officinalis] gb|ONK81417.1| uncharacterized protein A4U43_C01F28870 [Asparagus officinalis] Length = 1188 Score = 64.7 bits (156), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAKSQFSCRDYSDHLAL RAYEGWKDA Sbjct: 827 LADSAKSQFSCRDYSDHLALVRAYEGWKDA 856 >ref|XP_020696726.1| DExH-box ATP-dependent RNA helicase DExH3 [Dendrobium catenatum] Length = 1205 Score = 64.3 bits (155), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAKSQFSCRDYSDHLAL RAYEGWKDA Sbjct: 844 LADSAKSQFSCRDYSDHLALIRAYEGWKDA 873 >ref|XP_020570937.1| DExH-box ATP-dependent RNA helicase DExH3 [Phalaenopsis equestris] Length = 1207 Score = 64.3 bits (155), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAKSQFSCRDYSDHLAL RAYEGWKDA Sbjct: 843 LADSAKSQFSCRDYSDHLALIRAYEGWKDA 872 >ref|XP_010926080.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Elaeis guineensis] Length = 1214 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAKSQFSCRDYSDHLAL RAYEGWKDA Sbjct: 855 LAESAKSQFSCRDYSDHLALVRAYEGWKDA 884 >ref|XP_008811383.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Phoenix dactylifera] Length = 1216 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAKSQFSCRDYSDHLAL RAYEGWKDA Sbjct: 857 LAESAKSQFSCRDYSDHLALVRAYEGWKDA 886 >gb|PKA49264.1| putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Apostasia shenzhenica] Length = 1054 Score = 62.8 bits (151), Expect = 2e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAKSQFSCRDYSDHL L RAYEGWKDA Sbjct: 693 LADSAKSQFSCRDYSDHLTLIRAYEGWKDA 722 >gb|OAY75283.1| ATP-dependent RNA helicase DHX36 [Ananas comosus] Length = 1228 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAK+QFSCRDYSDHLAL RA++GWKDA Sbjct: 865 LADSAKAQFSCRDYSDHLALIRAFDGWKDA 894 >ref|XP_020088309.1| DExH-box ATP-dependent RNA helicase DExH3-like [Ananas comosus] Length = 1229 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAK+QFSCRDYSDHLAL RA++GWKDA Sbjct: 866 LADSAKAQFSCRDYSDHLALIRAFDGWKDA 895 >gb|KHN24317.1| Putative ATP-dependent RNA helicase DHX36 [Glycine soja] Length = 412 Score = 58.9 bits (141), Expect = 3e-06 Identities = 33/99 (33%), Positives = 55/99 (55%) Frame = +3 Query: 477 SNVTLPPYQFQRHWNMKVNYLRLCTRMITQILSTFLEFGQSPSSCRINSSLKKFKSNLPK 656 S LPP+QF + ++ L + ++ ++F + ++ K +S+LP Sbjct: 10 SRTLLPPFQFILKLSSILSNNLLPAPHLPRVQDLTMQFPRMITNHIPFIVDKSLQSSLPF 69 Query: 657 IYLKLRMI*LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 + ++ + +AKS+FS +DYSDH+AL RAYEGWKDA Sbjct: 70 PFFLFHILVITGTAKSRFSAKDYSDHMALVRAYEGWKDA 108 >ref|XP_009393597.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Musa acuminata subsp. malaccensis] Length = 1215 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAKSQFSCRDYSDHLAL RA++GWKD+ Sbjct: 856 LAESAKSQFSCRDYSDHLALVRAFDGWKDS 885 >ref|XP_016196871.1| DExH-box ATP-dependent RNA helicase DExH3-like [Arachis ipaensis] Length = 189 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK+QFS RDYSDHLAL RAYEGWK+A Sbjct: 36 LAESAKAQFSARDYSDHLALVRAYEGWKEA 65 >ref|XP_015882948.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH3 [Ziziphus jujuba] Length = 1226 Score = 58.5 bits (140), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK+QFS RDYSDHLAL RAYEGWKDA Sbjct: 853 LAESAKAQFSARDYSDHLALVRAYEGWKDA 882 >dbj|BAS70109.1| Os01g0118100, partial [Oryza sativa Japonica Group] Length = 818 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 448 LAESAKLQFSCRDYSDHLALVRAYEGWREA 477 >dbj|BAD52491.1| putative DEAD/H box polypeptide 36 protein [Oryza sativa Japonica Group] Length = 1063 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 693 LAESAKLQFSCRDYSDHLALVRAYEGWREA 722 >ref|XP_015698231.1| PREDICTED: LOW QUALITY PROTEIN: DExH-box ATP-dependent RNA helicase DExH3-like [Oryza brachyantha] Length = 1097 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 718 LAESAKLQFSCRDYSDHLALVRAYEGWREA 747 >ref|XP_022886106.1| DExH-box ATP-dependent RNA helicase DExH3 [Olea europaea var. sylvestris] Length = 1187 Score = 58.2 bits (139), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LADSAK+QFS RD+SDHLAL RAYEGWKDA Sbjct: 824 LADSAKAQFSARDFSDHLALLRAYEGWKDA 853 >gb|KQK02430.1| hypothetical protein BRADI_2g01360v3 [Brachypodium distachyon] Length = 1216 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 875 LAESAKLQFSCRDYSDHLALVRAYEGWREA 904 >ref|XP_004968012.1| DExH-box ATP-dependent RNA helicase DExH3 [Setaria italica] Length = 1240 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 868 LAESAKLQFSCRDYSDHLALVRAYEGWREA 897 >gb|PAN31925.1| hypothetical protein PAHAL_E03838 [Panicum hallii] Length = 1241 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 868 LAESAKLQFSCRDYSDHLALVRAYEGWREA 897 >ref|XP_021313012.1| DExH-box ATP-dependent RNA helicase DExH3 [Sorghum bicolor] gb|KXG32067.1| hypothetical protein SORBI_3003G095900 [Sorghum bicolor] Length = 1241 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 684 LADSAKSQFSCRDYSDHLALTRAYEGWKDA 773 LA+SAK QFSCRDYSDHLAL RAYEGW++A Sbjct: 868 LAESAKLQFSCRDYSDHLALVRAYEGWREA 897