BLASTX nr result
ID: Ophiopogon25_contig00015908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00015908 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242155.1| hydroxyproline O-arabinosyltransferase 1-lik... 63 6e-09 >ref|XP_020242155.1| hydroxyproline O-arabinosyltransferase 1-like [Asparagus officinalis] gb|ONK59602.1| uncharacterized protein A4U43_C08F8150 [Asparagus officinalis] Length = 367 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 399 PQSVVTLVKMVNEATANIPNWDAYVDGSSSN 307 PQSVVTLVKMVNEATANIPNWDAYV+GS+SN Sbjct: 337 PQSVVTLVKMVNEATANIPNWDAYVNGSNSN 367