BLASTX nr result
ID: Ophiopogon25_contig00015816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00015816 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67576.1| uncharacterized protein A4U43_C05F1470 [Asparagus... 100 7e-22 ref|XP_020263973.1| uncharacterized protein LOC109839921 [Aspara... 100 7e-22 ref|XP_020085903.1| cell division cycle and apoptosis regulator ... 89 6e-18 ref|XP_020085900.1| cell division cycle and apoptosis regulator ... 89 6e-18 ref|XP_008781072.2| PREDICTED: LOW QUALITY PROTEIN: cell divisio... 86 5e-17 ref|XP_019191331.1| PREDICTED: cell division cycle and apoptosis... 83 6e-16 ref|XP_019191330.1| PREDICTED: cell division cycle and apoptosis... 83 6e-16 ref|XP_019191329.1| PREDICTED: cell division cycle and apoptosis... 83 6e-16 ref|XP_019191328.1| PREDICTED: cell division cycle and apoptosis... 83 6e-16 ref|XP_010921529.1| PREDICTED: cell division cycle and apoptosis... 82 1e-15 gb|KRH70775.1| hypothetical protein GLYMA_02G109900 [Glycine max] 82 1e-15 gb|KHN14495.1| Cell division cycle and apoptosis regulator prote... 82 1e-15 ref|XP_003520085.1| PREDICTED: cell division cycle and apoptosis... 82 1e-15 ref|XP_021663017.1| cell division cycle and apoptosis regulator ... 81 3e-15 ref|XP_021613886.1| cell division cycle and apoptosis regulator ... 81 3e-15 ref|XP_021613884.1| cell division cycle and apoptosis regulator ... 81 3e-15 ref|XP_021663014.1| cell division cycle and apoptosis regulator ... 81 3e-15 gb|POO03502.1| Cell cycle and apoptosis regulator protein [Trema... 81 3e-15 ref|XP_021691855.1| cell division cycle and apoptosis regulator ... 80 5e-15 ref|XP_021663015.1| cell division cycle and apoptosis regulator ... 80 7e-15 >gb|ONK67576.1| uncharacterized protein A4U43_C05F1470 [Asparagus officinalis] Length = 1678 Score = 99.8 bits (247), Expect = 7e-22 Identities = 48/67 (71%), Positives = 57/67 (85%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RLFISPE +K+VLHWP QSLHLS+ TPVSFEHEYV+++NKG EKAL S+ SR KH NT Sbjct: 484 RLFISPEFTKLVLHWPNQSLHLSLQTPVSFEHEYVELENKG-EKALDSAGEPSRTKHENT 542 Query: 182 IWNAKVV 202 +WNAKV+ Sbjct: 543 VWNAKVI 549 >ref|XP_020263973.1| uncharacterized protein LOC109839921 [Asparagus officinalis] Length = 2121 Score = 99.8 bits (247), Expect = 7e-22 Identities = 48/67 (71%), Positives = 57/67 (85%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RLFISPE +K+VLHWP QSLHLS+ TPVSFEHEYV+++NKG EKAL S+ SR KH NT Sbjct: 484 RLFISPEFTKLVLHWPNQSLHLSLQTPVSFEHEYVELENKG-EKALDSAGEPSRTKHENT 542 Query: 182 IWNAKVV 202 +WNAKV+ Sbjct: 543 VWNAKVI 549 >ref|XP_020085903.1| cell division cycle and apoptosis regulator protein 1 isoform X2 [Ananas comosus] Length = 1317 Score = 88.6 bits (218), Expect = 6e-18 Identities = 47/113 (41%), Positives = 69/113 (61%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RL I+P+ SKVVL+WPK+SL++S+HTPVSFEH+ V+VD K DE LVSS + G+T Sbjct: 432 RLAIAPDFSKVVLNWPKESLYISLHTPVSFEHDIVEVDEKADENGLVSSSKSATPNGGDT 491 Query: 182 IWNAKVVAALCSKVPFLGNAIMKATQSVVKSLRSQ*RLMKLRIAVNALKFRLL 340 +WNAKV+ + +A + + ++ R++ N LKF +L Sbjct: 492 VWNAKVI--------LMSGISSEALEDICSDKSTEGRIIHFN---NVLKFAVL 533 >ref|XP_020085900.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] ref|XP_020085901.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] ref|XP_020085902.1| cell division cycle and apoptosis regulator protein 1 isoform X1 [Ananas comosus] Length = 1321 Score = 88.6 bits (218), Expect = 6e-18 Identities = 47/113 (41%), Positives = 69/113 (61%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RL I+P+ SKVVL+WPK+SL++S+HTPVSFEH+ V+VD K DE LVSS + G+T Sbjct: 432 RLAIAPDFSKVVLNWPKESLYISLHTPVSFEHDIVEVDEKADENGLVSSSKSATPNGGDT 491 Query: 182 IWNAKVVAALCSKVPFLGNAIMKATQSVVKSLRSQ*RLMKLRIAVNALKFRLL 340 +WNAKV+ + +A + + ++ R++ N LKF +L Sbjct: 492 VWNAKVI--------LMSGISSEALEDICSDKSTEGRIIHFN---NVLKFAVL 533 >ref|XP_008781072.2| PREDICTED: LOW QUALITY PROTEIN: cell division cycle and apoptosis regulator protein 1 [Phoenix dactylifera] Length = 1459 Score = 85.9 bits (211), Expect = 5e-17 Identities = 38/67 (56%), Positives = 54/67 (80%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RL I+P+ SKV+L+WP++SL+LS+HTPVSFEH++++VD+K EK VS D L + K G Sbjct: 530 RLAIAPDFSKVILNWPRESLNLSLHTPVSFEHDFLEVDDKAVEKGTVSLDELLKSKGGAA 589 Query: 182 IWNAKVV 202 +WNAKV+ Sbjct: 590 VWNAKVI 596 >ref|XP_019191331.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X4 [Ipomoea nil] Length = 1492 Score = 82.8 bits (203), Expect = 6e-16 Identities = 39/70 (55%), Positives = 53/70 (75%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LS---RMKH 172 RLFISPECSKVV++WPK +L LS++TPVSFEH++V+ + ++K L S S R+ H Sbjct: 516 RLFISPECSKVVINWPKGNLKLSLYTPVSFEHDFVEGETANEQKMLSPSKSASASERLDH 575 Query: 173 GNTIWNAKVV 202 G T+WNAKV+ Sbjct: 576 GVTVWNAKVI 585 >ref|XP_019191330.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X3 [Ipomoea nil] Length = 1540 Score = 82.8 bits (203), Expect = 6e-16 Identities = 39/70 (55%), Positives = 53/70 (75%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LS---RMKH 172 RLFISPECSKVV++WPK +L LS++TPVSFEH++V+ + ++K L S S R+ H Sbjct: 516 RLFISPECSKVVINWPKGNLKLSLYTPVSFEHDFVEGETANEQKMLSPSKSASASERLDH 575 Query: 173 GNTIWNAKVV 202 G T+WNAKV+ Sbjct: 576 GVTVWNAKVI 585 >ref|XP_019191329.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X2 [Ipomoea nil] Length = 1540 Score = 82.8 bits (203), Expect = 6e-16 Identities = 39/70 (55%), Positives = 53/70 (75%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LS---RMKH 172 RLFISPECSKVV++WPK +L LS++TPVSFEH++V+ + ++K L S S R+ H Sbjct: 516 RLFISPECSKVVINWPKGNLKLSLYTPVSFEHDFVEGETANEQKMLSPSKSASASERLDH 575 Query: 173 GNTIWNAKVV 202 G T+WNAKV+ Sbjct: 576 GVTVWNAKVI 585 >ref|XP_019191328.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 isoform X1 [Ipomoea nil] Length = 1556 Score = 82.8 bits (203), Expect = 6e-16 Identities = 39/70 (55%), Positives = 53/70 (75%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LS---RMKH 172 RLFISPECSKVV++WPK +L LS++TPVSFEH++V+ + ++K L S S R+ H Sbjct: 516 RLFISPECSKVVINWPKGNLKLSLYTPVSFEHDFVEGETANEQKMLSPSKSASASERLDH 575 Query: 173 GNTIWNAKVV 202 G T+WNAKV+ Sbjct: 576 GVTVWNAKVI 585 >ref|XP_010921529.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 [Elaeis guineensis] ref|XP_010921530.1| PREDICTED: cell division cycle and apoptosis regulator protein 1 [Elaeis guineensis] Length = 1443 Score = 82.0 bits (201), Expect = 1e-15 Identities = 38/67 (56%), Positives = 52/67 (77%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVSSD*LSRMKHGNT 181 RL I+PE SKV+L+WP++SL+LS+ TPVSFEH+ ++VD+K EK VS D + K G T Sbjct: 512 RLAIAPEFSKVILNWPRESLNLSLQTPVSFEHDLLEVDDKDVEKGTVSLDESLKSKSGAT 571 Query: 182 IWNAKVV 202 +WNAKV+ Sbjct: 572 VWNAKVI 578 >gb|KRH70775.1| hypothetical protein GLYMA_02G109900 [Glycine max] Length = 1405 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 5/72 (6%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDN-----KGDEKALVSSD*LSRM 166 RLF+SPE SKVV++WPK++L LSIHTPVSFEH++V+ +N K LV L Sbjct: 482 RLFVSPEFSKVVVNWPKENLKLSIHTPVSFEHDFVEEENATEPRDSSNKLLVGQ--LPNS 539 Query: 167 KHGNTIWNAKVV 202 +HGNT+WNAK++ Sbjct: 540 EHGNTVWNAKII 551 >gb|KHN14495.1| Cell division cycle and apoptosis regulator protein 1, partial [Glycine soja] Length = 1436 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 5/72 (6%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDN-----KGDEKALVSSD*LSRM 166 RLF+SPE SKVV++WPK++L LSIHTPVSFEH++V+ +N K LV L Sbjct: 472 RLFVSPEFSKVVVNWPKENLKLSIHTPVSFEHDFVEEENATEPRDSSNKLLVGQ--LPNS 529 Query: 167 KHGNTIWNAKVV 202 +HGNT+WNAK++ Sbjct: 530 EHGNTVWNAKII 541 >ref|XP_003520085.1| PREDICTED: cell division cycle and apoptosis regulator protein 1-like [Glycine max] gb|KRH70774.1| hypothetical protein GLYMA_02G109900 [Glycine max] Length = 1439 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 5/72 (6%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDN-----KGDEKALVSSD*LSRM 166 RLF+SPE SKVV++WPK++L LSIHTPVSFEH++V+ +N K LV L Sbjct: 482 RLFVSPEFSKVVVNWPKENLKLSIHTPVSFEHDFVEEENATEPRDSSNKLLVGQ--LPNS 539 Query: 167 KHGNTIWNAKVV 202 +HGNT+WNAK++ Sbjct: 540 EHGNTVWNAKII 551 >ref|XP_021663017.1| cell division cycle and apoptosis regulator protein 1-like isoform X3 [Hevea brasiliensis] Length = 1367 Score = 80.9 bits (198), Expect = 3e-15 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 4/71 (5%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVK----VDNKGDEKALVSSD*LSRMK 169 RLFISPE SKVV++WPK++L LSIHTPVSFEH++++ V++K + + L + + Sbjct: 454 RLFISPELSKVVINWPKENLKLSIHTPVSFEHDFIEDEGVVNSKEPPSTKLFAQQLEKSE 513 Query: 170 HGNTIWNAKVV 202 HG TIWNAK++ Sbjct: 514 HGRTIWNAKII 524 >ref|XP_021613886.1| cell division cycle and apoptosis regulator protein 1-like isoform X2 [Manihot esculenta] gb|OAY50059.1| hypothetical protein MANES_05G104800 [Manihot esculenta] Length = 1379 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVS---SD*LSRMKH 172 RLFISPE SKVV++WPK++L LSIHTPVSFEH++++ ++ + K S S L + +H Sbjct: 474 RLFISPELSKVVINWPKENLKLSIHTPVSFEHDFIEDESVPEPKEHPSTKLSTQLEKSEH 533 Query: 173 GNTIWNAKVV 202 G+TIWNAK++ Sbjct: 534 GHTIWNAKII 543 >ref|XP_021613884.1| cell division cycle and apoptosis regulator protein 1-like isoform X1 [Manihot esculenta] ref|XP_021613885.1| cell division cycle and apoptosis regulator protein 1-like isoform X1 [Manihot esculenta] Length = 1382 Score = 80.9 bits (198), Expect = 3e-15 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVS---SD*LSRMKH 172 RLFISPE SKVV++WPK++L LSIHTPVSFEH++++ ++ + K S S L + +H Sbjct: 474 RLFISPELSKVVINWPKENLKLSIHTPVSFEHDFIEDESVPEPKEHPSTKLSTQLEKSEH 533 Query: 173 GNTIWNAKVV 202 G+TIWNAK++ Sbjct: 534 GHTIWNAKII 543 >ref|XP_021663014.1| cell division cycle and apoptosis regulator protein 1-like isoform X1 [Hevea brasiliensis] Length = 1397 Score = 80.9 bits (198), Expect = 3e-15 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 4/71 (5%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVK----VDNKGDEKALVSSD*LSRMK 169 RLFISPE SKVV++WPK++L LSIHTPVSFEH++++ V++K + + L + + Sbjct: 484 RLFISPELSKVVINWPKENLKLSIHTPVSFEHDFIEDEGVVNSKEPPSTKLFAQQLEKSE 543 Query: 170 HGNTIWNAKVV 202 HG TIWNAK++ Sbjct: 544 HGRTIWNAKII 554 >gb|POO03502.1| Cell cycle and apoptosis regulator protein [Trema orientalis] Length = 1422 Score = 80.9 bits (198), Expect = 3e-15 Identities = 37/70 (52%), Positives = 53/70 (75%), Gaps = 3/70 (4%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEK---ALVSSD*LSRMKH 172 RLFISPE SK V++WPK+++ LSIHTPVSFEH++V+ ++ G K + S+ S+ H Sbjct: 492 RLFISPEFSKAVVYWPKENIKLSIHTPVSFEHDFVEEESTGGSKKDSTDLLSEETSKSGH 551 Query: 173 GNTIWNAKVV 202 GNT+WNAK++ Sbjct: 552 GNTVWNAKLI 561 >ref|XP_021691855.1| cell division cycle and apoptosis regulator protein 1-like isoform X1 [Hevea brasiliensis] ref|XP_021691863.1| cell division cycle and apoptosis regulator protein 1-like isoform X2 [Hevea brasiliensis] Length = 1384 Score = 80.1 bits (196), Expect = 5e-15 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 4/71 (5%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVKVDNKGDEKALVS----SD*LSRMK 169 RLFISPE SKVV++WPK++L LSIHTPVSFEH++++ ++ + K S + L + + Sbjct: 472 RLFISPEFSKVVINWPKENLKLSIHTPVSFEHDFIEDESVAESKEPPSTKLLTQQLEKSE 531 Query: 170 HGNTIWNAKVV 202 HG TIWNAK++ Sbjct: 532 HGRTIWNAKII 542 >ref|XP_021663015.1| cell division cycle and apoptosis regulator protein 1-like isoform X2 [Hevea brasiliensis] Length = 1397 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 4/71 (5%) Frame = +2 Query: 2 RLFISPECSKVVLHWPKQSLHLSIHTPVSFEHEYVK----VDNKGDEKALVSSD*LSRMK 169 RLFISPE SKVV++WPK++L LSIHTPVSFEH++ + V++K + + L + + Sbjct: 484 RLFISPELSKVVINWPKENLKLSIHTPVSFEHDFTEDEGVVNSKEPPSTKLLAQQLEKSE 543 Query: 170 HGNTIWNAKVV 202 HG TIWNAK++ Sbjct: 544 HGRTIWNAKII 554