BLASTX nr result
ID: Ophiopogon25_contig00015599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00015599 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273624.1| granule-bound starch synthase 1b, chloroplas... 67 7e-10 ref|XP_020273623.1| granule-bound starch synthase 1b, chloroplas... 67 7e-10 gb|AEQ94153.1| granule bound starch synthase Ia precursor, parti... 65 1e-09 dbj|BAI83440.1| granule-bound starch synthase I, partial [Ipomoe... 60 1e-09 dbj|BAI83434.1| granule-bound starch synthase I, partial [Ipomoe... 60 2e-09 ref|XP_012078417.1| granule-bound starch synthase 1, chloroplast... 65 3e-09 ref|XP_012078416.1| granule-bound starch synthase 1, chloroplast... 65 3e-09 ref|XP_008775302.1| PREDICTED: granule-bound starch synthase 1, ... 65 5e-09 ref|XP_010940833.1| PREDICTED: granule-bound starch synthase 1, ... 65 5e-09 gb|PNX73274.1| granule-bound starch synthase chloroplastic/amylo... 59 5e-09 gb|OAY71608.1| Granule-bound starch synthase 1, chloroplastic/am... 64 5e-09 gb|AAC70779.1| granule-bound glycogen (starch) synthase [Astraga... 64 6e-09 ref|XP_010917976.1| PREDICTED: granule-bound starch synthase 1b,... 64 6e-09 ref|XP_020112542.1| granule-bound starch synthase 1, chloroplast... 64 6e-09 ref|XP_021900468.1| granule-bound starch synthase 1, chloroplast... 64 8e-09 ref|XP_010252174.1| PREDICTED: granule-bound starch synthase 1, ... 64 8e-09 ref|NP_001289785.1| granule-bound starch synthase 1, chloroplast... 64 8e-09 ref|WP_095374874.1| hypothetical protein [Acinetobacter baumanni... 62 1e-08 ref|XP_021276394.1| granule-bound starch synthase 1, chloroplast... 64 1e-08 gb|PNX54823.1| granule-bound starch synthase chloroplastic/amylo... 59 1e-08 >ref|XP_020273624.1| granule-bound starch synthase 1b, chloroplastic/amyloplastic isoform X2 [Asparagus officinalis] gb|ONK64396.1| uncharacterized protein A4U43_C07F25410 [Asparagus officinalis] Length = 613 Score = 67.0 bits (162), Expect = 7e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQ+LLSLDVAGSEPG+DGEEIAPL+KENVATP Sbjct: 581 WEQMLLSLDVAGSEPGVDGEEIAPLAKENVATP 613 >ref|XP_020273623.1| granule-bound starch synthase 1b, chloroplastic/amyloplastic isoform X1 [Asparagus officinalis] Length = 644 Score = 67.0 bits (162), Expect = 7e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQ+LLSLDVAGSEPG+DGEEIAPL+KENVATP Sbjct: 612 WEQMLLSLDVAGSEPGVDGEEIAPLAKENVATP 644 >gb|AEQ94153.1| granule bound starch synthase Ia precursor, partial [Elaeis guineensis] Length = 205 Score = 64.7 bits (156), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQLLLSL+VAGSEPG+DGEEIAPL+K+NVATP Sbjct: 173 WEQLLLSLEVAGSEPGLDGEEIAPLAKQNVATP 205 >dbj|BAI83440.1| granule-bound starch synthase I, partial [Ipomoea batatas] Length = 38 Score = 60.5 bits (145), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE +LLSL VAGSEPGI+GEEIAPL+KENVATP Sbjct: 6 WETVLLSLGVAGSEPGIEGEEIAPLAKENVATP 38 >dbj|BAI83434.1| granule-bound starch synthase I, partial [Ipomoea batatas] Length = 38 Score = 60.1 bits (144), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE +LLSL VAGSEPG++GEEIAPL+KENVATP Sbjct: 6 WETVLLSLGVAGSEPGVEGEEIAPLAKENVATP 38 >ref|XP_012078417.1| granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X2 [Jatropha curcas] Length = 598 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE+LLLSL+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 566 WEKLLLSLEVAGSEPGIDGEEIAPLAKENVATP 598 >ref|XP_012078416.1| granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X1 [Jatropha curcas] gb|KDP32658.1| hypothetical protein JCGZ_14778 [Jatropha curcas] Length = 606 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE+LLLSL+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 574 WEKLLLSLEVAGSEPGIDGEEIAPLAKENVATP 606 >ref|XP_008775302.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic [Phoenix dactylifera] Length = 613 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQLLLSL+VAGSEPGIDGEEIAPL+KENVA P Sbjct: 581 WEQLLLSLEVAGSEPGIDGEEIAPLAKENVAAP 613 >ref|XP_010940833.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic [Elaeis guineensis] ref|XP_010940834.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic [Elaeis guineensis] ref|XP_019711014.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic [Elaeis guineensis] Length = 616 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQLLLSL+VAGSEPG+DGEEIAPL+K+NVATP Sbjct: 584 WEQLLLSLEVAGSEPGLDGEEIAPLAKQNVATP 616 >gb|PNX73274.1| granule-bound starch synthase chloroplastic/amyloplastic-like, partial [Trifolium pratense] Length = 38 Score = 58.9 bits (141), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE++LLSL V GSEPGIDGEEIAP +KENVATP Sbjct: 6 WEEVLLSLGVPGSEPGIDGEEIAPQAKENVATP 38 >gb|OAY71608.1| Granule-bound starch synthase 1, chloroplastic/amyloplastic, partial [Ananas comosus] Length = 406 Score = 64.3 bits (155), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQLLLSL V+GSEPGIDGEEIAPL+KENVATP Sbjct: 374 WEQLLLSLGVSGSEPGIDGEEIAPLAKENVATP 406 >gb|AAC70779.1| granule-bound glycogen (starch) synthase [Astragalus membranaceus] Length = 607 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQ LLSL+VAGSEPGIDGEE+APL+KENVATP Sbjct: 575 WEQALLSLEVAGSEPGIDGEEVAPLAKENVATP 607 >ref|XP_010917976.1| PREDICTED: granule-bound starch synthase 1b, chloroplastic/amyloplastic [Elaeis guineensis] Length = 621 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE++LLSL+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 589 WEEVLLSLEVAGSEPGIDGEEIAPLAKENVATP 621 >ref|XP_020112542.1| granule-bound starch synthase 1, chloroplastic/amyloplastic-like [Ananas comosus] Length = 730 Score = 64.3 bits (155), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WEQLLLSL V+GSEPGIDGEEIAPL+KENVATP Sbjct: 698 WEQLLLSLGVSGSEPGIDGEEIAPLAKENVATP 730 >ref|XP_021900468.1| granule-bound starch synthase 1, chloroplastic/amyloplastic [Carica papaya] Length = 613 Score = 63.9 bits (154), Expect = 8e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE++LLSLDVAGSEPGI+GEE+APL+KENVATP Sbjct: 581 WEKMLLSLDVAGSEPGIEGEEVAPLAKENVATP 613 >ref|XP_010252174.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X1 [Nelumbo nucifera] ref|XP_019054359.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X1 [Nelumbo nucifera] ref|XP_019055261.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X1 [Nelumbo nucifera] gb|ACM78591.1| granule-bound starch synthase [Nelumbo nucifera] Length = 615 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE +LLSL+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 583 WESILLSLEVAGSEPGIDGEEIAPLAKENVATP 615 >ref|NP_001289785.1| granule-bound starch synthase 1, chloroplastic/amyloplastic [Nelumbo nucifera] gb|ACH72975.1| granule-bound starch synthase [Nelumbo nucifera] Length = 615 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE +LLSL+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 583 WESILLSLEVAGSEPGIDGEEIAPLAKENVATP 615 >ref|WP_095374874.1| hypothetical protein [Acinetobacter baumannii] gb|PAL70311.1| hypothetical protein CEJ83_20340 [Acinetobacter baumannii] Length = 232 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE+ LL+L+VAGSEPGIDGEEIAPL+KENVATP Sbjct: 200 WEETLLNLEVAGSEPGIDGEEIAPLAKENVATP 232 >ref|XP_021276394.1| granule-bound starch synthase 1, chloroplastic/amyloplastic [Herrania umbratica] ref|XP_021276403.1| granule-bound starch synthase 1, chloroplastic/amyloplastic [Herrania umbratica] Length = 610 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE++LLSL+VAGSEPG++GEEIAPLSKENVATP Sbjct: 578 WEKMLLSLEVAGSEPGVEGEEIAPLSKENVATP 610 >gb|PNX54823.1| granule-bound starch synthase chloroplastic/amyloplastic-like, partial [Trifolium pratense] Length = 74 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 WEQLLLSLDVAGSEPGIDGEEIAPLSKENVATP 99 WE++LLSL V GSEPGIDGEEIAP +KENVATP Sbjct: 42 WEEVLLSLGVPGSEPGIDGEEIAPQAKENVATP 74