BLASTX nr result
ID: Ophiopogon25_contig00015308
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon25_contig00015308 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242652.1| disease resistance protein RPS2-like [Aspara... 42 3e-06 ref|XP_020244702.1| disease resistance protein RPS2-like [Aspara... 42 3e-06 gb|ONK59453.1| uncharacterized protein A4U43_C08F6580 [Asparagus... 42 3e-06 gb|ONK59428.1| uncharacterized protein A4U43_C08F6330 [Asparagus... 42 3e-06 >ref|XP_020242652.1| disease resistance protein RPS2-like [Asparagus officinalis] Length = 929 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = -3 Query: 280 MPLKIFTKKQISTF*QQINKIRVRIDLLTVENDSVFEQLQKLAADDRVSIIGIYGMAGWG 101 +PL + TK + +++ ++ + V + F++LQ+LA DD VSIIGIYGM G G Sbjct: 174 VPLDVATKLEANSYVERSGRAMVG-------REREFQRLQELAGDDDVSIIGIYGMGGVG 226 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 105 GVGKTRLLKKFFNKFPQRRHYDKMVWVDVGGSHNV 1 GVGKT LL KF+N+ + +D M+W+D+ H+V Sbjct: 224 GVGKTELLNKFYNETHLKDTHD-MIWIDMNACHSV 257 >ref|XP_020244702.1| disease resistance protein RPS2-like [Asparagus officinalis] Length = 885 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = -3 Query: 280 MPLKIFTKKQISTF*QQINKIRVRIDLLTVENDSVFEQLQKLAADDRVSIIGIYGMAGWG 101 +PL + TK + +++ ++ + V + F++LQ+LA DD VSIIGIYGM G G Sbjct: 130 VPLDVATKLEANSYVERSGRAMVG-------REREFQRLQELAGDDDVSIIGIYGMGGVG 182 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 105 GVGKTRLLKKFFNKFPQRRHYDKMVWVDVGGSHNV 1 GVGKT LL KF+N+ + +D M+W+D+ H+V Sbjct: 180 GVGKTELLNKFYNETHLKDTHD-MIWIDMNACHSV 213 >gb|ONK59453.1| uncharacterized protein A4U43_C08F6580 [Asparagus officinalis] Length = 845 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = -3 Query: 280 MPLKIFTKKQISTF*QQINKIRVRIDLLTVENDSVFEQLQKLAADDRVSIIGIYGMAGWG 101 +PL + TK + +++ ++ + V + F++LQ+LA DD VSIIGIYGM G G Sbjct: 90 VPLDVATKLEANSYVERSGRAMVG-------REREFQRLQELAGDDDVSIIGIYGMGGVG 142 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 105 GVGKTRLLKKFFNKFPQRRHYDKMVWVDVGGSHNV 1 GVGKT LL KF+N+ + +D M+W+D+ H+V Sbjct: 140 GVGKTELLNKFYNETHLKDTHD-MIWIDMNACHSV 173 >gb|ONK59428.1| uncharacterized protein A4U43_C08F6330 [Asparagus officinalis] Length = 813 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = -3 Query: 280 MPLKIFTKKQISTF*QQINKIRVRIDLLTVENDSVFEQLQKLAADDRVSIIGIYGMAGWG 101 +PL + TK + +++ ++ + V + F++LQ+LA DD VSIIGIYGM G G Sbjct: 58 VPLDVATKLEANSYVERSGRAMVG-------REREFQRLQELAGDDDVSIIGIYGMGGVG 110 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 105 GVGKTRLLKKFFNKFPQRRHYDKMVWVDVGGSHNV 1 GVGKT LL KF+N+ + +D M+W+D+ H+V Sbjct: 108 GVGKTELLNKFYNETHLKDTHD-MIWIDMNACHSV 141